Primary Antibodies

View as table Download

Rabbit Polyclonal FOXP3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rabbit polyclonal FOXP3 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human FOXP3. The immunogen is located within the last 50 amino acids of FOXP3.

Goat Polyclonal Antibody against FOXP3 / SCURFIN

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence SQRPSRCSNPTPGP, from the C Terminus of the protein sequence according to NP_054728.2.

Rabbit Polyclonal FoxP3 Antibody

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A peptide corresponding to amino acids 43-100 of mouse FOXP3. [Swiss-Prot# Q99JB6]

Rabbit Polyclonal Antibody against FOXP3

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to the C-terminal region of human FOXP3 (between residues 400-431).

Rabbit Polyclonal Anti-FOXP3 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXP3 antibody: synthetic peptide directed towards the N terminal of human FOXP3. Synthetic peptide located within the following region: PHFMHQLSTVDAHARTPVLQVHPLESPAMISLTPPTTATGVFSLKARPGL

Rabbit Polyclonal Antibody against FOXP3

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to the N-terminal region of human FOXP3 (between residues 1-50).

Rabbit anti FOXP3 Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the C-terminus of human FOXP3 protein. This sequence is identical within human, mouse, rat origins.

Anti-FOXP3 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 410-424 amino acids of Human forkhead box P3