Primary Antibodies

View as table Download

Rabbit Polyclonal antibody to PFKL (phosphofructokinase, liver)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 428 and 674 of PFKL (Uniprot ID#P17858)

PFKL rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat

Rabbit polyclonal anti-K6PL antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human K6PL.

Rabbit polyclonal PFKL Antibody (C-term L684)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This PFKL antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 669-699 amino acids from the C-terminal region of human PFKL.

PFKL rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 700-750 of Human PFKL.

Rabbit Polyclonal antibody to PFKL (phosphofructokinase, liver)

Reactivities Human

Rabbit Polyclonal Anti-PFKL Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PFKL antibody: synthetic peptide directed towards the middle region of human PFKL. Synthetic peptide located within the following region: RTNVLGHLQQGGAPTPFDRNYGTKLGVKAMLWLSEKLREVYRKGRVFANA

Rabbit Polyclonal Anti-PFKL Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PFKL

PFKL Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 700-780 of human PFKL (NP_002617.3).
Modifications Unmodified