Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal antibody to TCP1 beta (chaperonin containing TCP1, subunit 2 (beta))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 277 and 503 of TCP1 beta (Uniprot ID#P78371) |
Rabbit Polyclonal Anti-CCT2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CCT2 antibody is: synthetic peptide directed towards the middle region of CCT2. Synthetic peptide located within the following region: RVDSTAKVAEIEHAEKEKMKEKVERILKHGINCFINRQLIYNYPEQLFGA |
TCP1 beta/CCT2 Rabbit polyclonal Antibody
| Applications | IF, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 206-535 of human TCP1 beta/TCP1 beta/CCT2 (NP_006422.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- CCT2
Clonalities
- Polyclonal