Primary Antibodies

View as table Download

Rabbit anti-KLKB1 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human KLKB1

Plasma Kallikrein 1B (KLKB1) sheep polyclonal antibody, Ig Fraction

Applications ELISA, Ie, IHC
Reactivities Human
Immunogen KLKB1 antibody was raised against human Prekallikrein (PK) purified from plasma.

Rabbit polyclonal KLKB1 (heavy chain, Cleaved-Arg390) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human KLKB1.Purification: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen.
Modifications Phospho-specific

Rabbit Polyclonal Anti-Klkb1 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Klkb1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: GPLVCKHSGRWQLVGITSWGEGCARKEQPGVYTKVAEYIDWILEKIQSSK

Rabbit Polyclonal Anti-KLKB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KLKB1 antibody: synthetic peptide directed towards the middle region of human KLKB1. Synthetic peptide located within the following region: VLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVS

KLKB1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-300 of human KLKB1 (NP_000883.2).
Modifications Unmodified