Perilipin-1 (PLIN1) guinea pig polyclonal antibody, Serum
Applications | IHC, WB |
Reactivities | Bovine, Human, Mouse, Rat |
Immunogen | Duplicated N-terminus of Perilipin, aa 1-20 (cf. Greenberg et al. 1992, JBC 266, 11341-11346) |
Perilipin-1 (PLIN1) guinea pig polyclonal antibody, Serum
Applications | IHC, WB |
Reactivities | Bovine, Human, Mouse, Rat |
Immunogen | Duplicated N-terminus of Perilipin, aa 1-20 (cf. Greenberg et al. 1992, JBC 266, 11341-11346) |
Rabbit polyclonal anti-Perilipin A antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 510 of mouse Perilipin A. |
Perilipin-1 (PLIN1) (488-499) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Monkey |
Immunogen | Synthetic peptide from internal region of human PLIN |
Rabbit Polyclonal Perilipin Antibody
Applications | WB |
Reactivities | Bovine, Human, Mouse, Porcine, Rat, Sheep |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a region between residues 450-522 (C-terminus) of the human perilipin protein. [Swiss-Prot# O60240] |
Rabbit Polyclonal Anti-PLIN Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PLIN antibody: synthetic peptide directed towards the N terminal of human PLIN. Synthetic peptide located within the following region: STQFTAANELACRGLDHLEEKIPALQYPPEKIASELKDTISTRLRSARNS |
Perilipin-1 (PLIN1) (C-term) goat polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Bovine, Canine, Equine, Human, Monkey, Mouse |
Immunogen | Synthetic peptide from (C-term) of human PLIN |
Perilipin-1 (PLIN1) (C-term) guinea pig polyclonal antibody, Serum
Applications | IHC, WB |
Reactivities | Bovine, Human |
Immunogen | C-terminus of Perilipin-1 (hCTA/B; aa 507-519; cf. Greenberg et al. 1992, JBC 266, 11341-11346) |
Goat Polyclonal Antibody against PLIN
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-PREKPKRRVSDS, from the internal region (near the C Terminus) of the protein sequence according to NP_002657.2. |
Goat Polyclonal Antibody against PLIN (C-terminal)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-EPILGRAQYSQLRKK, from the C Terminus of the protein sequence according to NP_002657.2. |
Rabbit Polyclonal Anti-PLIN1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PLIN1 |
Rabbit Polyclonal Anti-PLIN1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PLIN1 |
Rabbit Polyclonal Anti-PLIN1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PLIN1 |