Primary Antibodies

View as table Download

TNFRSF11B Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TNFRSF11B

Osteoprotegerin (TNFRSF11B) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen Synthetic peptide

Rabbit polyclonal anti-TR11B antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human TR11B.

Rabbit Polyclonal Osteoprotegerin Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Anti-Human OPG Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human OPG

Osteoprotegerin (TNFRSF11B) goat polyclonal antibody, Aff - Purified

Applications ELISA
Reactivities Human
Immunogen Purified recombinant Human Osteoprotegerin

Osteoprotegerin (TNFRSF11B) goat polyclonal antibody, Aff - Purified

Applications ELISA
Reactivities Human
Immunogen Purified recombinant Human Osteoprotegerin

Rabbit polyclonal anti-TNFRSF11B (OPG) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen E. coli-expressed recombinant human OPG

Biotinylated Anti-Human OPG Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human OPG

Rabbit Polyclonal Anti-TNFRSF11B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TNFRSF11B antibody: synthetic peptide directed towards the N terminal of human TNFRSF11B. Synthetic peptide located within the following region: LDISIKWTTQETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTV

Anti-TNFRSF11B Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 195-365 amino acids of human tumor necrosis factor receptor superfamily, member 11b

Anti-TNFRSF11B Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 195-365 amino acids of human tumor necrosis factor receptor superfamily, member 11b

TNFRSF11B Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 22-280 of human TNFRSF11B (NP_002537.3).
Modifications Unmodified