Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-STK3 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-STK3 antibody: synthetic peptide directed towards the C terminal of human STK3. Synthetic peptide located within the following region: IEHNSTMLESDLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQ

Rabbit Polyclonal Anti-STK3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-STK3 antibody: synthetic peptide directed towards the N terminal of human STK3. Synthetic peptide located within the following region: MEQPPAPKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESG

Carrier-free (BSA/glycerol-free) STK3 mouse monoclonal antibody, clone OTI4G10 (formerly 4G10)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) STK3 mouse monoclonal antibody, clone OTI2D4 (formerly 2D4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-STK3/STK4 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human STK3/STK4

Anti-STK3 mouse monoclonal antibody, clone OTI4G10 (formerly 4G10)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Anti-STK3 mouse monoclonal antibody, clone OTI4G10 (formerly 4G10)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Anti-STK3 mouse monoclonal antibody, clone OTI2D4 (formerly 2D4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-STK3 mouse monoclonal antibody, clone OTI2D4 (formerly 2D4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated