Primary Antibodies

View as table Download

Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406)

Mouse Monoclonal GAPDH/G3PDH Antibody (13H12)

Applications IHC, WB
Reactivities Human, Mouse, Drosophila, Primate
Conjugation Unconjugated

Rabbit Polyclonal Anti-TPI1 Antibody

Applications WB
Reactivities Drosophila, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TPI1 antibody: synthetic peptide directed towards the N terminal of human TPI1. Synthetic peptide located within the following region: MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYID

Rabbit polyclonal ATP6V1B1 Antibody (Center)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ATP6V1B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 284-310 amino acids from the Central region of human ATP6V1B1.

Rabbit Polyclonal RNA Polymerase II/POLR2A [p Thr4] Antibody

Applications Dot, WB
Reactivities Human, Chicken, Drosophila, Yeast
Conjugation Unconjugated
Immunogen A synthetic peptide made to a phosphorylated Threonine (position 4) of the CTD heptad in the human RNA polymerase II protein [UniProt P24928]

Mouse monoclonal Anti-Cytochrome P450 4A11 Clone M25-P2A10

Applications IHC, WB
Reactivities Drosophila, Human, Mouse, Rat, Xenopus
Conjugation Unconjugated

Rabbit Polyclonal GAPDH/G3PDH Antibody

Applications WB
Reactivities Human, Mouse, Rat, Drosophila, Feline, Porcine, Protozoa
Conjugation Unconjugated
Immunogen Amino acids 73-87 PITIFQERDPSKIKW of glyceraldehyde 3-phosphate dehydrogenase protein were used as the immunogen.

Rabbit anti TK1 (Thymidine Kinase) Polyclonal Antibody

Applications WB
Reactivities Drosph
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the N-terminus of fruit fly thymidine kinase protein.