XRCC4 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human XRCC4 |
XRCC4 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human XRCC4 |
Rabbit Polyclonal antibody to XRCC4 (X-ray repair complementing defective repair in Chinese hamster cells 4)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 216 and 309 of XRCC4 (Uniprot ID#Q13426) |
Rabbit Polyclonal Anti-XRCC4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-XRCC4 Antibody: A synthesized peptide derived from human XRCC4 |
Rabbit polyclonal anti-XRCC4 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human XRCC4. |
Rabbit Polyclonal XRCC4 Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal Anti-XRCC4 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-XRCC4 antibody: synthetic peptide directed towards the middle region of human XRCC4. Synthetic peptide located within the following region: LQKENERLLRDWNDVQGRFEKCVSAKEALETDLYKRFILVLNEKKTKIRS |
Carrier-free (BSA/glycerol-free) XRCC4 mouse monoclonal antibody, clone OTI4H9 (formerly 4H9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-XRCC4 mouse monoclonal antibody, clone OTI4H9 (formerly 4H9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-XRCC4 mouse monoclonal antibody, clone OTI4H9 (formerly 4H9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |