Primary Antibodies

View as table Download

Rabbit anti-PTBP1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PTBP1

Rabbit Polyclonal Anti-PTBP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTBP1 antibody: synthetic peptide directed towards the N terminal of human PTBP1. Synthetic peptide located within the following region: RGSDELFSTCVTNGPFIMSSNSASAANGNDSKKFKGDSRSAGVPSRVIHI

Rabbit Polyclonal Anti-PTBP1 Antibody

Applications WB
Reactivities Bovine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish, Dog, Pig, Horse
Conjugation Unconjugated
Immunogen The immunogen for anti-PTBP1 antibody: synthetic peptide directed towards the middle region of human PTBP1. Synthetic peptide located within the following region: KGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI

PTBP1 (2-14) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Bovine, Hamster, Human, Monkey, Mouse, Porcine, Rat
Immunogen Synthetic peptide from N-term of human PTBP1

Goat Polyclonal Antibody against PTBP1

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence DGIVPDIAVGTKR-C, from the N Terminus of the protein sequence according to NP_002810.1; NP_114367.1; NP_114368.1; NP_787041.1.

Mouse Monoclonal anti-PTBP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated