Germany
Japan
United Kingdom
China
alpha Actinin (ACTN1) mouse monoclonal antibody, clone SA-20, Purified
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rabbit, Rat |
Primary Antibodies
View as table Downloadbeta Actin (ACTB) (Loading Control) mouse monoclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | All Species |
beta Actin (ACTB) mouse monoclonal antibody, clone 26F7, Aff - Purified
| Applications | WB |
| Reactivities | Chicken, Human, Mouse, Rabbit, Rat |
Rabbit Monoclonal Antibody against ACTN1 (Clone EP2527Y)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal EGFR (Thr693) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human: Thr693, Mouse: Thr695, Rat: Thr694 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of threonine 693 (P-L-TP-P-S). |
| Modifications | Phospho-specific |
Rabbit polyclonal Src (Tyr529) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Src around the phosphorylation site of tyrosine 529 (P-Q-YP-Q-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal SMAD3 phospho S423/phospho S425 antibody
| Applications | IHC, WB |
| Reactivities | Human, Zebrafish, Rat, Mouse, Swine, Bovine, Chicken |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 417-425 of human SMAD3 protein. |
Anti-SRC (Phospho-Tyr529) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of tyrosine 529 (P-Q-Y(p)-Q-P) derived from Human Src. |
| Modifications | Phospho-specific |
Rabbit Polyclonal ERK1/2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ERK1/2 |
Rabbit Polyclonal ERK1/2 (Thr202/Tyr204) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ERK1/2 around the phosphorylation site of Threonine 202/Tyrosine 204 |
| Modifications | Phospho-specific |
PVRL1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PVRL1 |
Rabbit Polyclonal Anti-TCF7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TCF7 antibody is: synthetic peptide directed towards the N-terminal region of Human TCF7. Synthetic peptide located within the following region: AGGGDDLGAPDELLAFQDEGEEQDDKSRDSAAGPERDLAELKSSLVNESE |
Mouse Monoclonal beta Actin Antibody
| Applications | WB |
| Reactivities | Goat, Hamster, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-Actin-pan Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Actin-pan Antibody: A synthesized peptide derived from human Actin-pan |
Rabbit Polyclonal Anti-E-cadherin Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-E-cadherin Antibody: A synthesized peptide derived from human E-cadherin |
Rabbit Polyclonal Anti-EGFR Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EGFR Antibody: A synthesized peptide derived from human EGFR |
Rabbit Polyclonal Anti-Beta actin antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Beta actin antibody: A synthesized peptide derived from human Beta actin |
Goat Polyclonal Anti-CTNNB1 / catenin beta-1 (aa108-121) Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CTNNB1 / catenin beta-1 (aa108-121) Antibody: Peptide with sequence C-QIPSTQFDAAHPTN, from the internal region of the protein sequence according to NP_001895.1. |
USD 379.00
In Stock
purified EGFR Capture mouse monoclonal antibody, Luminex validated, clone OTI1B10
| Applications | LMNX |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Matched ELISA Pair | TA700469 |
purified EGFR Capture mouse monoclonal antibody, Luminex validated, clone OTI2E1
| Applications | LMNX |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Matched ELISA Pair | TA700471 |
purified EGFR Capture mouse monoclonal antibody, Luminex validated, clone OTI3D7
| Applications | LMNX |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Matched ELISA Pair | TA700469 |
purified EGFR Capture mouse monoclonal antibody, Luminex validated, clone OTI3F2
| Applications | LMNX |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Matched ELISA Pair | TA700472 |
purified EGFR Capture mouse monoclonal antibody, Luminex validated, clone OTI11H7
| Applications | LMNX |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Matched ELISA Pair | TA700473 |
Goat Polyclonal Anti-ERBB1 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 1,162 aa to the C-terminus of human ERBB1 produced in E. coli. |
USD 530.00
2 Weeks
EGFR pTyr1069 (incl. pos. control) mouse monoclonal antibody, clone 11C2, Biotin
| Applications | ELISA, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Biotin |
USD 355.00
2 Weeks
EGFR (Ligand binding Site) mouse monoclonal antibody, clone EGF-R1, Purified
| Applications | ELISA, FC, IHC |
| Reactivities | Human |
EGFR (Ligand bdg. Dom.) mouse monoclonal antibody, clone EGF-R1, Purified
| Applications | ELISA, FC, IHC |
| Reactivities | Human |
beta Catenin (CTNNB1) mouse monoclonal antibody, clone IMD-110, Purified
| Applications | IF, IHC, WB |
| Reactivities | Chicken, Human, Rat |
Active filters
Families
- ES Cell Differentiation/IPS
Pathways
- Adherens junction
Filter by
Category
Target Symbol
Reactivities
- Human (543)
- Mouse (430)
- Rat (420)
- Monkey (105)
- Dog (90)
- Chicken (12)
- Bovine (8)
- Pig (7)
- Zebrafish (7)
- Canine (6)
- Drosophila (6)
- Rabbit (6)
- Xenopus (4)
- Hamster (3)
- Primate (3)
- Cow (2)
- X. tropicalis (2)
- All Species (1)
- Avian (1)
- Broad (1)
- Chimpanzee (1)
- Goat (1)
- Guinea Pig (1)
- Porcine (1)
- Rhesus Monkey (1)
- Sheep (1)