Primary Antibodies

View as table Download

Rabbit polyclonal NR1D2 Antibody (Center)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This NR1D2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 266-294 amino acids from the Central region of human NR1D2.

Rabbit Polyclonal Anti-NR1D2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR1D2 antibody: synthetic peptide directed towards the C terminal of human NR1D2. Synthetic peptide located within the following region: ETLIRALRTLIMKNHPNEASIFTKLLLKLPDLRSLNNMHSEELLAFKVHP

NR1D2 Rabbit Polyclonal (Ligand-binding Domain) Antibody

Applications IHC
Reactivities Human, Monkey, Gorilla, Gibbon
Immunogen NR1D2 antibody was raised against synthetic 19 amino acid peptide from ligand-binding domain of human NR1D2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Hamster, Elephant (89%); Mouse, Rat, Panda, Bat, Dog, Rabbit, Horse (84%).

NR1D2 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Human
Immunogen NR1D2 antibody was raised against synthetic 16 amino acid peptide from N-terminus of human NR1D2. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey, Marmoset, Panda, Dog (94%); Bovine, Bat, Horse (88%); Elephant (81%).

Rabbit Polyclonal Anti-NR1D2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR1D2 antibody: synthetic peptide directed towards the middle region of human NR1D2. Synthetic peptide located within the following region: MSLFTAVVLVSADRSGIENVNSVEALQETLIRALRTLIMKNHPNEASIFT

Rabbit Polyclonal Anti-NR1D2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR1D2 antibody: synthetic peptide directed towards the N terminal of human NR1D2. Synthetic peptide located within the following region: YISSSSSASSHASCHSEGSENSFQSSSSSVPSSPNSSNSDTNGNPKNGDL

Carrier-free (BSA/glycerol-free) NR1D2 mouse monoclonal antibody, clone OTI5E10 (formerly 5E10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NR1D2 mouse monoclonal antibody, clone OTI4G1 (formerly 4G1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NR1D2 mouse monoclonal antibody, clone OTI5C6 (formerly 5C6)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NR1D2 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NR1D2 mouse monoclonal antibody, clone OTI5E10 (formerly 5E10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NR1D2 mouse monoclonal antibody, clone OTI5E10 (formerly 5E10), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

NR1D2 mouse monoclonal antibody, clone OTI5E10 (formerly 5E10), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

NR1D2 mouse monoclonal antibody, clone OTI5E10 (formerly 5E10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NR1D2 mouse monoclonal antibody, clone OTI4G1 (formerly 4G1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NR1D2 mouse monoclonal antibody, clone OTI4G1 (formerly 4G1), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

NR1D2 mouse monoclonal antibody, clone OTI4G1 (formerly 4G1), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

NR1D2 mouse monoclonal antibody, clone OTI4G1 (formerly 4G1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NR1D2 mouse monoclonal antibody, clone OTI5C6 (formerly 5C6)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NR1D2 mouse monoclonal antibody, clone OTI5C6 (formerly 5C6), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

NR1D2 mouse monoclonal antibody, clone OTI5C6 (formerly 5C6), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

NR1D2 mouse monoclonal antibody, clone OTI5C6 (formerly 5C6)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NR1D2 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NR1D2 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

NR1D2 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

NR1D2 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated