Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-FBL Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FBL antibody: synthetic peptide directed towards the N terminal of human FBL. Synthetic peptide located within the following region: GGGFHSGGNRGRGRGGKRGNQSGKNVMVEPHRHEGVFICRGKEDALVTKN

FBL Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Monkey, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human FBL

Mouse Monoclonal Fibrillarin Antibody (38F3)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat, Chicken, Drosophila
Conjugation Unconjugated

Fibrillarin (FBL) (Nucleolar Marker) mouse monoclonal antibody

Applications IF, WB
Reactivities C. elegans, Drosophila, Human, Mouse
Conjugation Unconjugated

Goat Anti-Fibrillarin / FBL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KRVSISEGDDKIEYR, from the internal region of the protein sequence according to NP_001427.2.

Anti-FBL Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around aa.297~301( L-T-L-E-P) derived from Human Fibrillarin