Primary Antibodies

View as table Download

Rabbit polyclonal anti-ATF1 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ATF1.

ATF1 mouse monoclonal antibody, clone 3E7, Purified

Applications ELISA, IHC, WB
Reactivities Human

Rabbit Polyclonal ATF1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human ATF1

Rabbit Polyclonal ATF1 (Ser63) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human ATF1 around the phosphorylation site of Serine 63
Modifications Phospho-specific

ATF1 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide, corresponding to amino acids 20-70 of Human ATF1.

Rabbit Polyclonal anti-ATF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ATF1 antibody is: synthetic peptide directed towards the N-terminal region of Human ATF1. Synthetic peptide located within the following region: DLSSEDTRGRKGDGENSGVSAAVTSMSVPTPIYQTSSGQYIAIAPNGALQ

Rabbit Polyclonal anti-ATF1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATF1 antibody: synthetic peptide directed towards the middle region of human ATF1. Synthetic peptide located within the following region: YQIRTTPSATSLPQTVVMTSPVTLTSQTTKTDDPQLKREIRLMKNREAAR

Rabbit Polyclonal Anti-ATF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATF1 antibody: synthetic peptide directed towards the N terminal of human ATF1. Synthetic peptide located within the following region: ETAPQPGSAVQGAHISHIAQQVSSLSESEESQDSSDSIGSSQKAHGILAR

Rabbit Polyclonal Anti-ATF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATF1 antibody: synthetic peptide directed towards the C terminal of human ATF1. Synthetic peptide located within the following region: KNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKTLKDLYSNKSV

Mouse monoclonal Anti-ATF1 Clone ATF1 2A9/8

Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ATF1 mouse monoclonal antibody, clone OTI1D4 (formerly 1D4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ATF1 mouse monoclonal antibody, clone OTI2C2 (formerly 2C2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ATF1 mouse monoclonal antibody, clone OTI2B4 (formerly 2B4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ATF1 mouse monoclonal antibody, clone OTI6B7 (formerly 6B7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ATF1 mouse monoclonal antibody, clone OTI7H3 (formerly 7H3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ATF1 mouse monoclonal antibody, clone OTI5D10 (formerly 5D10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ATF1 mouse monoclonal antibody, clone OTI8G3 (formerly 8G3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-ATF1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ATF1

ATF1 mouse monoclonal antibody, clone OTI1D4 (formerly 1D4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ATF1 mouse monoclonal antibody, clone OTI1D4 (formerly 1D4), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

ATF1 mouse monoclonal antibody, clone OTI1D4 (formerly 1D4), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

ATF1 mouse monoclonal antibody, clone OTI1D4 (formerly 1D4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ATF1 mouse monoclonal antibody, clone OTI2C2 (formerly 2C2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ATF1 mouse monoclonal antibody, clone OTI2C2 (formerly 2C2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ATF1 mouse monoclonal antibody, clone OTI2B4 (formerly 2B4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ATF1 mouse monoclonal antibody, clone OTI2B4 (formerly 2B4), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

ATF1 mouse monoclonal antibody, clone OTI2B4 (formerly 2B4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ATF1 mouse monoclonal antibody, clone OTI6B7 (formerly 6B7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ATF1 mouse monoclonal antibody, clone OTI6B7 (formerly 6B7), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

ATF1 mouse monoclonal antibody, clone OTI6B7 (formerly 6B7), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

ATF1 mouse monoclonal antibody, clone OTI6B7 (formerly 6B7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ATF1 mouse monoclonal antibody, clone OTI7H3 (formerly 7H3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ATF1 mouse monoclonal antibody, clone OTI7H3 (formerly 7H3), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

ATF1 mouse monoclonal antibody, clone OTI7H3 (formerly 7H3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ATF1 mouse monoclonal antibody, clone OTI5D10 (formerly 5D10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ATF1 mouse monoclonal antibody, clone OTI5D10 (formerly 5D10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ATF1 mouse monoclonal antibody, clone OTI8G3 (formerly 8G3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ATF1 mouse monoclonal antibody, clone OTI8G3 (formerly 8G3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated