USD 430.00
2 Weeks
Carbonic Anhydrase IX (CA9) Marker mouse monoclonal antibody, clone 66.4.C2 (PN-15), Purified
Applications | FC, IF, IHC, IP, WB |
Reactivities | Equine, Human |
USD 430.00
2 Weeks
Carbonic Anhydrase IX (CA9) Marker mouse monoclonal antibody, clone 66.4.C2 (PN-15), Purified
Applications | FC, IF, IHC, IP, WB |
Reactivities | Equine, Human |
USD 240.00
2 Weeks
Carbonic Anhydrase IX (CA9) Marker mouse monoclonal antibody, clone 66.4.C2 (PN-15), Purified
Applications | FC, IF, IHC, IP, WB |
Reactivities | Equine, Human |
purified CA12 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI4D1
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700448 |
Rabbit Polyclonal Antibody against Carbonic Anhydrase IX
Applications | IHC, WB |
Reactivities | Human, Dog |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide derived from a C-terminal sequence of the human CA IX. |
Mouse Monoclonal Carbonic Anhydrase IX/CA9 Antibody (2D3)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CA4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CA4 antibody: synthetic peptide directed towards the middle region of human CA4. Synthetic peptide located within the following region: DGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGF |
Rabbit Polyclonal Anti-CA4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CA4 antibody: synthetic peptide directed towards the C terminal of human CA4. Synthetic peptide located within the following region: AFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLG |
purified CA12 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI1A6
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700448 |
purified CA12 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI3F1
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700449 |
purified CA12 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI4G3
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700450 |
Rabbit polyclonal anti-CA14 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CA14. |
Anti-CA14 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 26-290 amino acids of human carbonic anhydrase XIV |
Rabbit Polyclonal Carbonic Anhydrase IX Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody was made against a protein fragment from the N Terminus Region |
Goat Anti-carbonic anhydrase XII (aa188-199) Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-SHLQHVKYKGQE, from the internal region of the protein sequence according to NP_001209.1; NP_996808.1. |
Carbonic Anhydrase IX (CA9) (Center) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human CA9 |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) CA9 mouse monoclonal antibody, clone OTI1G7 (formerly 1G7)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CA12 mouse monoclonal antibody, clone OTI4D1 (formerly 4D1)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CA12 mouse monoclonal antibody, clone OTI2E9 (formerly 2E9)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CA12 mouse monoclonal antibody, clone OTI2C6 (formerly 2C6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CA12 mouse monoclonal antibody, clone OTI3F1 (formerly 3F1)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CA12 mouse monoclonal antibody, clone OTI4G3 (formerly 4G3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CA12 mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-CA14 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 26-290 amino acids of human carbonic anhydrase XIV |
Anti-CA4 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 19-284 amino acids of Human Carbonic anhydrase 4 |
Anti-CA4 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 19-284 amino acids of Human Carbonic anhydrase 4 |
USD 379.00
In Stock
Anti-CA9 (Carbonic Anhydrase IX) mouse monoclonal antibody, clone OTI1G7 (formerly 1G7)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
5 Days
CA9 mouse monoclonal antibody, clone 1G7, Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
5 Days
CA9 mouse monoclonal antibody, clone 1G7, HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
USD 159.00
2 Days
Anti-CA9 (Carbonic Anhydrase IX) mouse monoclonal antibody, clone OTI1G7 (formerly 1G7)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CA12 mouse monoclonal antibody, clone OTI4D1 (formerly 4D1)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CA12 mouse monoclonal antibody,clone 4D1, Biotinylated
Applications | IF, WB |
Reactivities | Human |
Conjugation | Biotin |
CA12 mouse monoclonal antibody,clone 4D1, HRP conjugated
Applications | IF, WB |
Reactivities | Human |
Conjugation | HRP |
CA12 mouse monoclonal antibody, clone OTI4D1 (formerly 4D1)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CA12 mouse monoclonal antibody, clone OTI2E9 (formerly 2E9)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CA12 mouse monoclonal antibody,clone 2E9, Biotinylated
Applications | IF, WB |
Reactivities | Human |
Conjugation | Biotin |
CA12 mouse monoclonal antibody,clone 2E9, HRP conjugated
Applications | IF, WB |
Reactivities | Human |
Conjugation | HRP |
CA12 mouse monoclonal antibody, clone OTI2E9 (formerly 2E9)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CA12 mouse monoclonal antibody, clone OTI2C6 (formerly 2C6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CA12 mouse monoclonal antibody,clone 2C6, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
CA12 mouse monoclonal antibody,clone 2C6, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
CA12 mouse monoclonal antibody, clone OTI2C6 (formerly 2C6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CA12 mouse monoclonal antibody, clone OTI3F1 (formerly 3F1)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CA12 mouse monoclonal antibody,clone 3F1, Biotinylated
Applications | FC, WB |
Reactivities | Human |
Conjugation | Biotin |
CA12 mouse monoclonal antibody,clone 3F1, HRP conjugated
Applications | FC, WB |
Reactivities | Human |
Conjugation | HRP |
CA12 mouse monoclonal antibody, clone OTI3F1 (formerly 3F1)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CA12 mouse monoclonal antibody, clone OTI4G3 (formerly 4G3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CA12 mouse monoclonal antibody,clone 4G3, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
CA12 mouse monoclonal antibody,clone 4G3, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
CA12 mouse monoclonal antibody, clone OTI4G3 (formerly 4G3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CA12 mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |