Primary Antibodies

View as table Download

Calca rabbit polyclonal antibody

Applications IF, IHC
Reactivities Human, Mammalian, Mouse, Porcine, Rat
Conjugation Unconjugated
Immunogen Synthetic rat alpha-CGRP coupled to bovine thyroglobulin (BTg) with glutaraldehyde.

Rabbit polyclonal anti-TUBB(beta Tubulin) antibody, Loading control

Applications WB
Reactivities Human, Mouse, Chicken, Xenopus, Porcine, Zebrafish, Hamster, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to the N-terminal region of human beta tubulin (within residues 1-100). Swiss-Prot P07437.

Rabbit Polyclonal Antibody against ATG5

Applications IHC, WB
Reactivities Human, Mouse, Porcine, Primate, Xenopus, Zebrafish, Cow, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an N-terminal region (within residues 1-50) of the human ATG5 protein. [Swiss-Prot# Q9H1Y0]

Rabbit Polyclonal Antibody against SAT1

Applications WB
Reactivities Human, Mouse, Porcine, Xenopus, Hamster, Cow, Rat, Chicken
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal region within residues 100-171 of the human protein. [Swiss-Prot# P21673]

Rabbit Polyclonal Ki-67/MKI67 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Porcine
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of human Ki67 (within residues 1550-1700) [Swiss-Prot# P46013]
TA336650 is a possible alternative to TA336566.

Rabbit Polyclonal Antibody against UCHL1 (PGP9.5) - Neuronal Marker - Neuronal Marker

Applications IHC, WB
Reactivities Human, Mouse, Monkey, Rat, Porcine, Horse
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the human UCHL1 protein (between residues 200-223). [UniProt# P09936]

Rabbit Polyclonal Antibody against PTGDS

Applications WB
Reactivities Human, Primate, Mouse, Rat, Bovine, Porcine, Feline, Equine, Dog
Conjugation Unconjugated
Immunogen The epitope recognized by this antibody maps to region within residue 1-50 of human PTGDS. [Swiss-Prot# P41222]

Rabbit Polyclonal Antibody against ADFP

Applications IHC, WB
Reactivities Bovine, Human, Monkey, Mouse, Porcine
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human protein, within residues 150-250. [Swiss-Prot# Q99541]

Rabbit Polyclonal Antibody against VPS34

Applications WB
Reactivities Human, Rat, Mouse, Porcine
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of the human protein (within residues 700-850). [Swiss-Prot# Q8NEB9]

Rabbit Polyclonal Antibody against VEGFA

Applications WB
Reactivities Human, Mouse, Dog, Horse, Cow, Rat, Chicken, Guinea Pig
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of the human VEGFA protein sequence (between residues 150-250). [Swiss-Prot# P15692]

Rabbit Polyclonal Antibody against LOX

Applications IHC, WB
Reactivities Human, Mouse, Rat, Porcine, Cow
Conjugation Unconjugated
Immunogen A cocktail of two synthetic peptides; one made to a region of the human LOX protein within residues 300-400 and one within residues 200-300

Rabbit polyclonal anti human / porcine / rat C-Type Natriuretic Peptide (CNP) (32-53)

Applications ELISA
Reactivities Human, Porcine, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide H-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu- Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys-OH (disulfide bond) coupled to carrier protein.

GAPDH mouse monoclonal antibody, clone 4G5

Applications ELISA, IF, WB
Reactivities Bovine, Feline, Goat, Human, Mouse, Porcine, Rat
Conjugation Unconjugated

Aurora B (AURKB) mouse monoclonal antibody

Applications IF, IHC, WB
Reactivities Bovine, Chicken, Equine, Human, Mouse, Porcine, Rat
Conjugation Unconjugated

Aurora C (AURKC) mouse monoclonal antibody

Applications IF, IHC, WB
Reactivities Bovine, Chicken, Equine, Human, Mouse, Porcine, Rat
Conjugation Unconjugated

Bestrophin (BEST1) mouse polyclonal antibody

Applications IF, WB
Reactivities Human, Porcine, Primate
Conjugation Unconjugated

Rabbit Polyclonal TLR5 Antibody

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat, Porcine
Conjugation Unconjugated
Immunogen This antibody was developed against KLH-conjugated synthetic peptide corresponding to a portion of human TLR5 found between amino acids 300-350. It will cross-react with mouse and rat TLR5.

Rabbit Polyclonal Antibody against TIP47

Applications WB
Reactivities Human, Primate, Porcine
Conjugation Unconjugated
Immunogen A synthetic peptide made to a region within the C-terminus (within residues 350-435) of the human TIP47 protein. [Swiss-Prot# O60664]

Rabbit anti-ACAT2 polyclonal antibody

Applications WB
Reactivities Human, Murine, Rat, Porcine, Ovine
Conjugation Unconjugated
Immunogen Synthetic peptide derived from Human ACAT 2

BMP4 (20-34) rabbit polyclonal antibody

Applications IHC
Reactivities Bovine, Chicken, Frog, Human, Mouse, Porcine, Rat, Zebrafish
Conjugation Unconjugated

Mouse Monoclonal anti-HSPA1A Antibody

Applications FC
Reactivities Human, Mouse, Rat, Bovine, dog, Chicken, Drosophila, Fish, Guinea Porcine, Hamster, Monkey, Porcine, Rabbit, Sheep
Conjugation Unconjugated

Rabbit anti-ACAT1 polyclonal antibody

Applications WB
Reactivities Human, Porcine, Rat, Murine
Conjugation Unconjugated
Immunogen Synthetic peptide derived from Human ACAT1.

Rabbit Polyclonal Anti-FLI1 Antibody

Applications WB
Reactivities Human, Porcine
Conjugation Unconjugated
Immunogen The immunogen for anti-FLI1 antibody: synthetic peptide directed towards the N terminal of human FLI1. Synthetic peptide located within the following region: MDGTIKEALSVVSDDQSLFDSAYGAAAHLPKADMTASGSPDYGQPHKINP

Rabbit Polyclonal Gastrokine 1 Antibody

Applications WB
Reactivities Human, Equine, Porcine, Primate
Conjugation Unconjugated
Immunogen The portions of amino acids range between 100-150 of human GKN1 was used as the immunogen.

Atrial Natriuretic Factor (1-28) (hu, bo, po); purified rabbit IgG

Applications ELISA
Reactivities Human, Bovine, Porcine
Conjugation Unconjugated
Immunogen Synthetic peptide H-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met- Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr-OH (Disulfide bond) coupled to carrier protein.