Rabbit anti-RAD17 Polyclonal Antibody
Applications | IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RAD17 |
Rabbit anti-RAD17 Polyclonal Antibody
Applications | IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RAD17 |
Rabbit Polyclonal Anti-RAD17 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RAD17 Antibody: A synthesized peptide derived from human RAD17 |
Rabbit polyclonal RAD17 (Ab-646) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human RAD17. |
Rabbit Polyclonal anti-RAD17 antibody
Applications | WB |
Reactivities | Human, Mouse, Xenopus |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RAD17 antibody: synthetic peptide directed towards the C terminal of human RAD17. Synthetic peptide located within the following region: PTQATVPETWSLPLSQNSASELPASQPQPFSAQGDMEENIIIEDYESDGT |
Rabbit Polyclonal anti-RAD17 antibody
Applications | WB |
Reactivities | Human, Mouse, Xenopus |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RAD17 antibody: synthetic peptide directed towards the N terminal of human RAD17. Synthetic peptide located within the following region: MNQVTDWVDPSFDDFLECSGVSTITATSLGVNNSSHRRKNGPSTLESSRF |
Rabbit Polyclonal Anti-RAD17 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human RAD17 |
RAD17 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human RAD17 |