Rabbit anti-SOD1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SOD1 |
Rabbit anti-SOD1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SOD1 |
Rabbit Polyclonal Anti-SOD1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SOD1 antibody is: synthetic peptide directed towards the C-terminal region of Human SOD1. Synthetic peptide located within the following region: DVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLA |
Anti-SOD1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 2-159 amino acids of human superoxide dismutase 1, soluble |
Rabbit Polyclonal Anti-SOD1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SOD1 Antibody: Synthetic peptide from SOD1 |
Rabbit polyclonal SOD (Cu/Zn) Antibody
Applications | IF, WB |
Reactivities | Bovine, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Sheep, Xenopus, Dog, Pig, Coral |
Conjugation | Unconjugated |
Immunogen | Human Cu/Zn SOD |
Rabbit Polyclonal Anti-SOD1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SOD1 antibody: synthetic peptide directed towards the N terminal of human SOD1. Synthetic peptide located within the following region: MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHE |
Goat Polyclonal Antibody against SOD1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-SRKHGGPKDEERH, from the internal region of the protein sequence according to NP_000445.1. |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) SOD1 mouse monoclonal antibody, clone OTI8B10 (formerly 8B10)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 379.00
In Stock
SOD1 (Superoxide Dismutase 1) mouse monoclonal antibody, clone OTI8B10 (formerly 8B10)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
5 Days
SOD1 mouse monoclonal antibody, clone 8B10, Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
5 Days
SOD1 mouse monoclonal antibody, clone 8B10, HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
USD 159.00
2 Days
SOD1 (Superoxide Dismutase 1) mouse monoclonal antibody, clone OTI8B10 (formerly 8B10)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |