Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-CRH Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen CRH antibody was raised against a 16 amino acid peptide near the amino terminus of human CRH.

Rabbit Polyclonal Anti-CRH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CRH antibody is: synthetic peptide directed towards the C-terminal region of Human CRH. Synthetic peptide located within the following region: GGHQEAPERERRSEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLM

Corticotropin Releasing Factor (CRH) rabbit polyclonal antibody

Applications IF, IHC
Reactivities Mammalian
Conjugation Unconjugated

Rabbit Polyclonal Anti-CRH Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CRH