Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-AADAT Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AADAT Antibody: synthetic peptide directed towards the N terminal of human AADAT. Synthetic peptide located within the following region: AVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTI

Rabbit anti-AADAT polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide derived from Human AADAT.

Rabbit polyclonal anti-AASS antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen he antiserum was produced against synthesized peptide derived from internal of human AASS.

Rabbit Polyclonal Anti-AASDHPPT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AASDHPPT antibody: synthetic peptide directed towards the C terminal of human AASDHPPT. Synthetic peptide located within the following region: SRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEE

Rabbit polyclonal anti-AASDHPPT antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human AASDHPPT.

KATII / AADAT Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human
Immunogen KATII / AADAT antibody was raised against synthetic 17 amino acid peptide from N-terminus of human AADAT. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Elephant (100%); Monkey, Rabbit (94%); Marmoset, Dog (82%).

KATII / AADAT Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Human, Monkey, Gorilla, Gibbon
Immunogen KATII / AADAT antibody was raised against synthetic 17 amino acid peptide from internal region of human AADAT. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Marmoset (100%); Monkey (88%); Dog, Elephant (82%).

AASS (C-term) rabbit polyclonal antibody, Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 812-841 amino acids from the C-terminal region of human AASS.

Goat Polyclonal Antibody against AADAT

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KPEDAKNPQKNTPK, from the internal region of the protein sequence according to NP_057312.1; NP_872603.1.

KATII / AADAT Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Human
Immunogen KATII / AADAT antibody was raised against synthetic 17 amino acid peptide from internal region of human AADAT. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (94%); Marmoset (88%); Panda, Pig (82%).

Rabbit Polyclonal Anti-AADAT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AADAT Antibody: synthetic peptide directed towards the middle region of human AADAT. Synthetic peptide located within the following region: EIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKI

Aminoadipate aminotransferase (AADAT) (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 203-232 amino acids from the Central region of human AADAT

Rabbit Polyclonal Anti-AASDH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AASDH antibody: synthetic peptide directed towards the middle region of human AASDH. Synthetic peptide located within the following region: TDGKVWILESQSGQLQSVYELPGEVFSSPVVLESMLIIGCRDNYVYCLDL

Rabbit Polyclonal Anti-AASS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AASS antibody is: synthetic peptide directed towards the C-terminal region of Human AASS. Synthetic peptide located within the following region: HHHLVRKTDAVYDPAEYDKHPERYISRFNTDIAPYTTCLINGIYWEQNTP

Anti-AASDHPPT Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Anti-AASDHPPT Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein