Primary Antibodies

View as table Download

XRCC4 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human XRCC4

Rabbit Polyclonal antibody to XRCC4 (X-ray repair complementing defective repair in Chinese hamster cells 4)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 216 and 309 of XRCC4 (Uniprot ID#Q13426)

Rabbit Polyclonal Anti-XRCC4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-XRCC4 Antibody: A synthesized peptide derived from human XRCC4

Rabbit polyclonal anti-XRCC4 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human XRCC4.

Rabbit Polyclonal XRCC4 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit Polyclonal Anti-XRCC4 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-XRCC4 antibody: synthetic peptide directed towards the middle region of human XRCC4. Synthetic peptide located within the following region: LQKENERLLRDWNDVQGRFEKCVSAKEALETDLYKRFILVLNEKKTKIRS

Carrier-free (BSA/glycerol-free) XRCC4 mouse monoclonal antibody, clone OTI4H9 (formerly 4H9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-XRCC4 mouse monoclonal antibody, clone OTI4H9 (formerly 4H9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-XRCC4 mouse monoclonal antibody, clone OTI4H9 (formerly 4H9), Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin

Anti-XRCC4 mouse monoclonal antibody, clone OTI4H9 (formerly 4H9), HRP conjugated

Applications IHC, WB
Reactivities Human
Conjugation HRP

Anti-XRCC4 mouse monoclonal antibody, clone OTI4H9 (formerly 4H9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated