Primary Antibodies

View as table Download

USD 450.00

Backordered

Rabbit polyclonal NEU2 Antibody (N-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This NEU2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 23-50 amino acids from the N-terminal region of human NEU2.

Rabbit polyclonal Neuraminidase antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 110-124 of Human Neu2.

Rabbit Polyclonal Anti-NEU2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NEU2 antibody is: synthetic peptide directed towards the N-terminal region of Human NEU2. Synthetic peptide located within the following region: ANVTRLCQVTSTDHGRTWSSPRDLTDAAIGPAYREWSTFAVGPGHCLQLH

Carrier-free (BSA/glycerol-free) NEU2 mouse monoclonal antibody, clone OTI5E1 (formerly 5E1)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NEU2 mouse monoclonal antibody, clone OTI4F4 (formerly 4F4)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NEU2 mouse monoclonal antibody, clone OTI8C12 (formerly 8C12)

Applications WB
Reactivities Human
Conjugation Unconjugated

NEU2 Antibody

Applications IHC
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the following sequence SGAHAYRIPALLYLPGQQSLLAFAEQRASKKDEHAELIVLRRGDYDAPTH

NEU2 mouse monoclonal antibody, clone OTI5E1 (formerly 5E1)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

NEU2 mouse monoclonal antibody, clone OTI5E1 (formerly 5E1)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

NEU2 mouse monoclonal antibody, clone OTI4F4 (formerly 4F4)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

NEU2 mouse monoclonal antibody, clone OTI4F4 (formerly 4F4)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

NEU2 mouse monoclonal antibody, clone OTI8C12 (formerly 8C12)

Applications WB
Reactivities Human
Conjugation Unconjugated

NEU2 mouse monoclonal antibody, clone OTI8C12 (formerly 8C12), Biotinylated

Applications WB
Reactivities Human
Conjugation Biotin

NEU2 mouse monoclonal antibody, clone OTI8C12 (formerly 8C12), HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

NEU2 mouse monoclonal antibody, clone OTI8C12 (formerly 8C12)

Applications WB
Reactivities Human
Conjugation Unconjugated