Primary Antibodies

View as table Download

Rabbit Polyclonal TLR9 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TLR9 antibody was raised against a peptide corresponding to 15 amino acids near the center of human TLR9.

Mouse Monoclonal TLR9 Antibody (26C593.2)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat, Canine, Equine, Primate
Conjugation Unconjugated

Rabbit Polyclonal TLR9 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen TLR9 antibody was raised against a peptide corresponding to 16 amino acids near the carboxy terminus of human TLR9.

TLR9 (N-term) goat polyclonal antibody, Purified

Applications ELISA, IF, IHC, WB
Reactivities Hamster, Mouse
Immunogen Synthetic peptide LSLKYNNLTKVPRQLPPSLEY-C corresponding to amino acids 204-224 of the N-terminal domain of mouse TLR9

TLR9 (26-300) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen Recombinant protein fragment containing a sequence corresponding to a region within amino acids 26 and 300 of Human CD289(TLR9)

TLR9 (1050-1100) rabbit polyclonal antibody

Applications WB
Reactivities Human, Primate, Rat
Conjugation Unconjugated

Rat Anti-Human CD289 (TLR9) Purified (25 ug)

Applications FC
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-TLR9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TLR9 Antibody: synthetic peptide directed towards the N terminal of human TLR9. Synthetic peptide located within the following region: VGGNCRRCDHAPNPCMECPRHFPQLHPDTFSHLSRLEGLVLKDSSLSWLN