Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Mouse Monoclonal anti-CNGA1 Antibody
| Applications | IHC |
| Reactivities | Fish, Mouse, Rat |
| Conjugation | Unconjugated |
Mouse monoclonal Hsp70/Hsc70 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Bovine, C.elegans, Beluga, Canine, Chicken, Drosophila, Fish, Guinea pig, Hamster, Monkey, Pig, Plant, Rabbit, Sheep, Xenopus |
| Conjugation | Unconjugated |
Rabbit Polyclonal anti-CALR Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Dog, Chicken, Drosophila, Fish, Guinea Porcine, Hamster, Monkey, Porcine, Rabbit, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Human calreticulin synthetic peptide with a cysteine residue added and the peptide conjugated to KLH |
Rabbit polyclonal anti-ATR antibody
| Applications | WB |
| Reactivities | Fish, Human, Monkey, Mouse, Rat, Xenopus, Dog |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human ATR protein. |
Rabbit Polyclonal Anti-OMA1 Antibody
| Applications | WB |
| Reactivities | Fish, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OMA1 antibody: synthetic peptide directed towards the middle region of human OMA1. Synthetic peptide located within the following region: WAICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACA |
Goat Polyclonal Antibody against TRPM7
| Applications | WB |
| Reactivities | Mouse, Rat, CrayFish |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TKESESTNSVRLML, from the C Terminus of the protein sequence according to NP_060142.2. |
Mouse monoclonal Hsp70 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Amphibian, Chicken, Fish, Saccharomyces cerevisiae, Fruit Fly |
| Conjugation | Unconjugated |
Cardiac Troponin T (TNNT2) mouse monoclonal antibody, clone 2F3
| Applications | ELISA |
| Reactivities | Fish, Mammalian |
| Conjugation | Unconjugated |
Mouse Monoclonal anti-HSPA1A Antibody
| Applications | FC |
| Reactivities | Human, Mouse, Rat, Bovine, dog, Chicken, Drosophila, Fish, Guinea Porcine, Hamster, Monkey, Porcine, Rabbit, Sheep |
| Conjugation | Unconjugated |
Rabbit polyclonal anti-PCNA antibody
| Applications | WB |
| Reactivities | Bovine, Chicken, Fish, Human, Monkey, Mouse, Rat, Xenopus, Dog |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human PCNA protein. |
Mouse monoclonal Hsp70 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Amphibian, Chicken, Fish, Saccharomyces cerevisiae, Fruit Fly |
| Conjugation | Unconjugated |
Mouse monoclonal Hsp70 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Amphibian, Chicken, Fish, Saccharomyces cerevisiae, Fruit Fly |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-HSPA1L Antibody
| Applications | WB |
| Reactivities | Human, Lamprey, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-HSPA1L Antibody: synthetic peptide directed towards the C terminal of human HSPA1L. Synthetic peptide located within the following region: DEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD |
Rabbit Polyclonal SOX2 Antibody
| Applications | WB |
| Reactivities | Fish, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Reacts with residues 113-127 of the 37 kDa (predicted molecular weight is 34 kDa) human, mouse and rat SOX-2 protein. Sequence is 100% conserved in most species. |
Active filters
Reactivities
- Fish
Filter by
Category
Target Symbol
Antibody Hosts
Clonalities
Conjugates
Families
- Druggable Genome (7)
- Protein Kinase (3)
- Stem cell - Pluripotency (3)
- Transcription Factors (3)
- ES Cell Differentiation/IPS (2)
- Transmembrane (2)
- Adult stem cells (1)
- Cancer stem cells (1)
- Embryonic stem cells (1)
- Induced pluripotent stem cells (1)
- Ion Channels: Transient receptor potential (1)
- Protease (1)
- Secreted Protein (1)
Pathways
- Antigen processing and presentation (9)
- MAPK signaling pathway (9)
- Endocytosis (8)
- Spliceosome (8)
- Prion diseases (5)
- Cell cycle (2)
- Pathways in cancer (2)
- Amyotrophic lateral sclerosis (ALS) (1)
- Base excision repair (1)
- Calcium signaling pathway (1)
- DNA replication (1)
- ErbB signaling pathway (1)
- Fc epsilon RI signaling pathway (1)
- Fc gamma R-mediated phagocytosis (1)
- Focal adhesion (1)
- Gap junction (1)
- Glioma (1)
- GnRH signaling pathway (1)
- Leukocyte transendothelial migration (1)
- Long-term depression (1)
- Long-term potentiation (1)
- Melanogenesis (1)
- Mismatch repair (1)
- Natural killer cell mediated cytotoxicity (1)
- Non-small cell lung cancer (1)
- Nucleotide excision repair (1)
- Pathogenic Escherichia coli infection (1)
- Phosphatidylinositol signaling system (1)
- Renal cell carcinoma (1)
- Tight junction (1)
- VEGF signaling pathway (1)
- Vascular smooth muscle contraction (1)
- Vibrio cholerae infection (1)
- Wnt signaling pathway (1)
- p53 signaling pathway (1)