Primary Antibodies

View as table Download

Rabbit Polyclonal Antibody against TRPM8 (Center R536)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This TRPM8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 521-552 amino acids from the Central region of human TRPM8.

Rabbit Polyclonal TRPM8 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human TRPM8 protein (between residues 250-300) [UniProt Q7Z2W7]

Rabbit Polyclonal Anti-TRPM8 (extracellular)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide SDVDGTTYDFAHC, corresponding to amino acid residues 917-929 of human TRPM8. 3rd extracellular loop.

Rabbit Polyclonal Antibody against TRPM8 (C-term C940)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This TRPM8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 926-956 amino acids from the C-terminal region of human TRPM8.

Rabbit polyclonal TRPM8 Antibody (Center)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This TRPM8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 263-292 amino acids from the Central region of human TRPM8.

Rabbit Polyclonal Anti-TRPM8 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRPM8 antibody: synthetic peptide directed towards the N terminal of human TRPM8. Synthetic peptide located within the following region: YILDNNHTHLLLVDNGCHGHPTVEAKLRNQLEKYISERTIQDSNYGGKIP

Rabbit Polyclonal Antibody against TRPM8 (C-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This TRPM8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1075-1104 amino acids from the C-terminal region of human TRPM8.

Rabbit Polyclonal TRPM8 Antibody

Applications IHC, WB
Reactivities Drosophila, Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptides made to residues 278-292 RNQLEKYISERTIQD and the C-terminus sequence NDLKGLLKEIANKIK of the human trp-p8 protein.

Rabbit Polyclonal Anti-TRPM8 Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen TRPM8 antibody was raised against synthetic 15 amino acid peptide from internal region of human TRPM8. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Baboon, Monkey, Mouse, Rat, Hamster, Elephant, Panda, Bat, Dog, Rabbit, Horse, Guinea pig, Turkey, Chicken, Armadillo, Platypus (100%); Galago, Marmoset, Bovine, Pig, Opossum, Xenopus (93%); Lizard (87%).

Carrier-free (BSA/glycerol-free) TRPM8 mouse monoclonal antibody,clone OTI7A11

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-TRPM8 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human TRPM8

TRPM8 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of human TRPM8

TRPM8 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human TRPM8

TRPM8 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 880-960 of human TRPM8 (NP_076985.4).
Modifications Unmodified

TRPM8 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 980-1104 of human TRPM8 (NP_076985.4).
Modifications Unmodified

TRPM8 mouse monoclonal antibody,clone OTI7A11

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TRPM8 mouse monoclonal antibody,clone OTI7A11

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated