Primary Antibodies

View as table Download

Rabbit Polyclonal NOD5 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen NOD5 antibody was raised against a 14 amino acid synthetic peptide near the amino terminus of human NOD5.

Rabbit Polyclonal NLRX1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Equine, Primate
Conjugation Unconjugated
Immunogen A portion of amino acid 580-630 of human NLRX1 was used as the immunogen for the antibody.

Rabbit Polyclonal Anti-NLRX1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NLRX1 antibody is: synthetic peptide directed towards the N-terminal region of Human NLRX1. Synthetic peptide located within the following region: GSHLLFVLHGLEHLNLDFRLAGTGLCSDPEEPQEPAAIIVNLLRKYMLPQ

Carrier-free (BSA/glycerol-free) NLRX1 mouse monoclonal antibody,clone OTI4H8

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NLRX1 Rabbit polyclonal Antibody

Applications IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 87-360 of human NLRX1 (NP_001269073.1).
Modifications Unmodified

NLRX1 mouse monoclonal antibody,clone OTI4H8

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NLRX1 mouse monoclonal antibody,clone OTI4H8

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated