Rabbit Polyclonal Anti-AMACR Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human AMACR |
Rabbit Polyclonal Anti-AMACR Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human AMACR |
Mouse Monoclonal AMACR (C-terminus) Antibody
Applications | IF, WB |
Reactivities | Rat |
Conjugation | Unconjugated |
AMACR (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 330-359 amino acids from the C-terminal region of human AMACR |
Rabbit Polyclonal Anti-AMACR Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AMACR antibody: synthetic peptide directed towards the C terminal of human AMACR. Synthetic peptide located within the following region: IFDGTDACVTPVLTFEEVVHHDHNKERGSFITSEEQDVSPRPAPLLLNTP |
Rabbit anti-AMACR Polyclonal Antibody
Applications | WB |
Reactivities | Human Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human AMACR |
Goat Anti-AMACR Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QLNSDKIIESN, from the C Terminus of the protein sequence according to NP_055139.4; NP_001161067.1 |
Goat Anti-AMACR (aa312-326) Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-RGSFITSEEQDVSPR, from the internal region of the protein sequence according to NP_055139.4; NP_001161067.1 |
Rabbit anti AMACR Polyclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AMACR mouse monoclonal antibody,clone OTI2A11
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AMACR mouse monoclonal antibody, clone OTI5G8 (formerly 5G8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AMACR mouse monoclonal antibody, clone OTI4G5 (formerly 4G5)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AMACR mouse monoclonal antibody,clone OTI5F10
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AMACR mouse monoclonal antibody, clone OTI2E3 (formerly 2E3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AMACR mouse monoclonal antibody, clone OTI4D12 (formerly 4D12)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AMACR mouse monoclonal antibody, clone OTI3H10 (formerly 3H10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AMACR mouse monoclonal antibody, clone OTI3E10 (formerly 3E10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AMACR mouse monoclonal antibody, clone OTI6C7 (formerly 6C7)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Alpha-Methylacyl-CoA Racemase (AMACR, p504s) Mouse Monoclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
AMACR rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human AMACR |
AMACR mouse monoclonal antibody,clone OTI2A11
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
5 Days
AMACR mouse monoclonal antibody,clone 2A11, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
AMACR mouse monoclonal antibody,clone 2A11, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
AMACR mouse monoclonal antibody,clone OTI2A11
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
AMACR mouse monoclonal antibody, clone OTI5G8 (formerly 5G8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
AMACR mouse monoclonal antibody, clone OTI5G8 (formerly 5G8), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
AMACR mouse monoclonal antibody, clone OTI5G8 (formerly 5G8), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
AMACR mouse monoclonal antibody, clone OTI5G8 (formerly 5G8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
AMACR mouse monoclonal antibody, clone OTI4G5 (formerly 4G5)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
AMACR mouse monoclonal antibody,clone 4G5, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
AMACR mouse monoclonal antibody,clone 4G5, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
AMACR mouse monoclonal antibody, clone OTI4G5 (formerly 4G5)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
AMACR mouse monoclonal antibody,clone OTI5F10
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
5 Days
AMACR mouse monoclonal antibody,clone 5F10, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
AMACR mouse monoclonal antibody,clone 5F10, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
AMACR mouse monoclonal antibody,clone OTI5F10
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
AMACR mouse monoclonal antibody, clone OTI2E3 (formerly 2E3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
AMACR mouse monoclonal antibody, clone OTI2E3 (formerly 2E3), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
AMACR mouse monoclonal antibody, clone OTI2E3 (formerly 2E3), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
AMACR mouse monoclonal antibody, clone OTI2E3 (formerly 2E3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
AMACR mouse monoclonal antibody, clone OTI4D12 (formerly 4D12)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
AMACR mouse monoclonal antibody, clone OTI4D12 (formerly 4D12), Biotinylated
Applications | IHC |
Reactivities | Human |
Conjugation | Biotin |
AMACR mouse monoclonal antibody, clone OTI4D12 (formerly 4D12), HRP conjugated
Applications | IHC |
Reactivities | Human |
Conjugation | HRP |
AMACR mouse monoclonal antibody, clone OTI4D12 (formerly 4D12)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
AMACR mouse monoclonal antibody, clone OTI3H10 (formerly 3H10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
AMACR mouse monoclonal antibody, clone OTI3H10 (formerly 3H10), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
AMACR mouse monoclonal antibody, clone OTI3H10 (formerly 3H10), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
AMACR mouse monoclonal antibody, clone OTI3H10 (formerly 3H10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
AMACR mouse monoclonal antibody, clone OTI3E10 (formerly 3E10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
AMACR mouse monoclonal antibody, clone OTI3E10 (formerly 3E10), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
AMACR mouse monoclonal antibody, clone OTI3E10 (formerly 3E10), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |