Primary Antibodies

View as table Download

IL13 receptor alpha 1 (IL13RA1) (Extracell. Dom.) mouse monoclonal antibody, clone GM1E7, Purified

Applications Assay, ELISA, FC, IF, WB
Reactivities Human

IL13 receptor alpha 1 (IL13RA1) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal IL-13R/CD213a1 (Tyr405) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human IL-13R/CD213a1 around the phosphorylation site of tyrosine 405 (D-I-YP-E-K).
Modifications Phospho-specific

Rabbit Polyclonal Anti-IL13RA1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-IL13RA1 antibody is: synthetic peptide directed towards the N-terminal region of IL13RA1. Synthetic peptide located within the following region: VSVENLCTVIWTWNPPEGASSNCSLWYFSHFGDKQDKKIAPETRRSIEVP

Anti-IL13RA1 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 25-363 amino acids of Human Interleukin 13 receptor, alpha 1

IL13RA1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human I13R1

IL13RA1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 22-343 of human IL13RA1 (NP_001551.1).
Modifications Unmodified