Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-PTHLH Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTHLH antibody: synthetic peptide directed towards the middle region of human PTHLH. Synthetic peptide located within the following region: YKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLS

Rabbit polyclonal anti pTH-Related Protein (1-34) (hu, ms, rt); neat antiserum

Applications ELISA
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide H-Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly- Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala- Glu-Ile-His-Thr-Ala-OH (Disulfide bond) coupled to carrier protein.

Rabbit polyclonal anti (Tyr36)-pTH-Related Protein (1-36); neat antiserum

Applications ELISA
Reactivities Chicken
Conjugation Unconjugated
Immunogen Synthetic peptide H-Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly- Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala- Glu-Ile-His-Thr-Ala-OH (Disulfide bond) coupled to carrier protein.

Guinea pig polyclonal anti pTH-Related Protein (1-34) (hu, ms, rt); neat antiserum

Applications ELISA
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide H-Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly- Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala- Glu-Ile-His-Thr-Ala-OH (Disulfide bond) coupled to carrier protein.

Rabbit Polyclonal PTHLH Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

Rabbit Polyclonal Anti-Pthlh Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Pthlh antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: EVSPNSKPAPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKK

Rabbit polyclonal anti-PTHrP antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen E. coli expressed human PTHrP

Biotinylated Anti-Human PTHrP Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human PTHrP

Anti-Human PTHrP Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human PTHrP

Rabbit polyclonal anti pTH-Related Protein (1-34) (hu, ms, rt); diluted antiserum

Applications ELISA
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide H-Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly- Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala- Glu-Ile-His-Thr-Ala-OH (Disulfide bond) coupled to carrier protein.

Rabbit polyclonal anti human / rat Parathyroid Hormone Related Protein (pTH-Related Protein), (1-34)

Applications ELISA
Reactivities Human, Rat
Conjugation Unconjugated

Rabbit polyclonal anti (Tyr36)-pTH-Related Protein (1-36) (ck); diluted antiserum

Applications ELISA
Reactivities Chicken
Conjugation Unconjugated
Immunogen Synthetic peptide H-Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly- Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Ile-Phe-Leu-Gln-Asn-Leu-Ile-Glu- Gly-Val-Asn-Thr-Ala-Glu-Tyr-NH2 coupled to carrier protein.

Rabbit polyclonal anti (Tyr36)-pTH-Related Protein (1-36) (ck); purified rabbit IgG

Applications ELISA
Reactivities Chicken
Conjugation Unconjugated

Anti-PTHLH Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 37-177 amino acids of human parathyroid hormone-like hormone

Anti-PTHLH Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 37-177 amino acids of human parathyroid hormone-like hormone

PTHLH Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 25-175 of human PTHLH (NP_945315.1).
Modifications Unmodified