Primary Antibodies

View as table Download

Goat Polyclonal Antibody against SERPINE1

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-GFKIDDKGMAPALRH, from the internal region of the protein sequence according to NP_000593.1.

PAI1 (SERPINE1) (71-85) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen Synthetic peptide from internal region of Human PAI1 (NP_000593.1; NP_001158885.1)

Rabbit polyclonal SERPINE1 Antibody (Center)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This SERPINE1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 188-216 amino acids from the Central region of human SERPINE1.

PAI1 (SERPINE1) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

Rabbit Polyclonal Serpin E1/PAI-1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human PAI1/Serpine 1 protein (between residues 300-400) [UniProt P05121]

Rabbit Polyclonal Anti-SERPINE1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SERPINE1 antibody: synthetic peptide directed towards the C terminal of human SERPINE1. Synthetic peptide located within the following region: VNESGTVASSSTAVIVSARMAPEEIIMDRPFLFVVRHNPTGTVLFMGQVM

Anti-Human PAI-1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human PAI-1

Rabbit Polyclonal Anti-SERPINE1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SERPINE1 antibody: synthetic peptide directed towards the N terminal of human SERPINE1. Synthetic peptide located within the following region: VAHLASDFGVRVFQQVAQASKDRNVVFSPYGVASVLAMLQLTTGGETQQQ

Anti-SERPINE1 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 24-324 amino acids of human serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 1

PAI-1/Serpin E1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 24-158 of human PAI-1/Serpin E1 (NP_000593.1).
Modifications Unmodified

PAI-1/Serpin E1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 24-402 of human PAI-1/Serpin E1 (NP_000593.1).
Modifications Unmodified

PAI1 Rabbit monoclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated