Primary Antibodies

View as table Download

Rabbit anti-SIAH1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SIAH1

SIAH1 (+SIAH2) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat

Rabbit Polyclonal Anti-SIAH1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SIAH1 antibody: synthetic peptide directed towards the N terminal of human SIAH1. Synthetic peptide located within the following region: FTCLPAARTRKRKEMSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLA

Rabbit Polyclonal Anti-SIAH1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SIAH1 Antibody: synthetic peptide directed towards the C terminal of human SIAH1. Synthetic peptide located within the following region: LVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATP

Mouse Monoclonal SIAH1/2 Antibody (8G7H12)

Applications WB
Reactivities Human, Rat, Drosophila, Porcine, Zebrafish, Mouse
Conjugation Unconjugated

SIAH1 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 91-121 amino acids from the Central region of human SIAH1.

Goat Polyclonal Antibody against SIAH1

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence SRQTATALPTGTSKC, from the N Terminus of the protein sequence according to NP_003022.3; NP_001006611.1.

Rabbit Polyclonal Anti-SIAH1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

SIAH1 Antibody - middle region

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of rat SIAH1A

SIAH1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human SIAH1

SIAH1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-313 of human SIAH1 (NP_001006611.1).
Modifications Unmodified