Glutathione Peroxidase 1 (GPX1) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 164-193aa) of human Glutathione peroxidase 1 / GPX1. |
Rabbit polyclonal GCLM Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This GCLM antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 246-274 amino acids from the C-terminal region of human GCLM. |
GST3 (GSTP1) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | A peptide mapping at the C-terminus of GSTpi of human origin |
Rabbit polyclonal antibody to glutathione transferase (glutathione S-transferase pi 1)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 63 of GSTP1 (Uniprot ID#P09211) |
Rabbit polyclonal GSTP1 Antibody (C-term)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GSTP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 165-192 amino acids from the C-terminal region of human GSTP1. |
Rabbit Polyclonal Anti-GSR Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GSR Antibody: synthetic peptide directed towards the N terminal of human GSR. Synthetic peptide located within the following region: PTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELP |
Germany
Japan
United Kingdom
China
