Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit Polyclonal Anti-TMPRSS6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMPRSS6 antibody: synthetic peptide directed towards the N terminal of human TMPRSS6. Synthetic peptide located within the following region: LLWYFLGYKAEVMVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQK |
Rabbit Polyclonal Anti-HNRPD Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPD antibody: synthetic peptide directed towards the C terminal of human HNRPD. Synthetic peptide located within the following region: YGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKP |
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit polyclonal IRS-1 (Ab-312) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human IRS-1 around the phosphorylation site of serine 312 (A-T-SP-P-A). |
USD 380.00
In Stock
Active filters
Applications
- IHC
Antibody Hosts
- Rabbit
Families
- Druggable Genome
Availabilities
- In Stock
Filter by
Target Symbol
- AKT1 (8)
- PAK1 (7)
- ESR1 (6)
- GCG (6)
- MUC1 (6)
- APAF1 (5)
- ATF2 (5)
- BAD (5)
- BRAF (5)
- CASP7 (5)
- CASP9 (5)
- DEFA1 (5)
- HSPD1 (5)
- JUN (5)
- NR3C1 (5)
- ADD1 (4)
- AFP (4)
- AKR1B1 (4)
- AMD1 (4)
- BAX (4)
- BIRC6 (4)
- CASP3 (4)
- CCNB1 (4)
- CCNE1 (4)
- CD274 (4)
- CFLAR (4)
- ERBB3 (4)
- FADD (4)
- GEMIN2 (4)
- GNAS (4)
- GPT (4)
- GSK3A (4)
- HDAC1 (4)
- HDAC2 (4)
- JUND (4)
- JUP (4)
- KAT5 (4)
- LOX (4)
- MAP2K4 (4)
- MAP2K6 (4)
- MME (4)
- MTOR (4)
- NTRK1 (4)
- PMS2 (4)
- RAF1 (4)
- RPS6KB1 (4)
- SCARB1 (4)
- SRC (4)
- STAT3 (4)
- STAT5B (4)
- TRPC6 (4)
- WT1 (4)
- XRCC6 (4)
- AATK (3)
- ACVR1C (3)
- ADM (3)
- ADRB3 (3)
- AGT (3)
- AHR (3)
- AK1 (3)
- AKAP8 (3)
- AKAP8L (3)
- AKT2 (3)
- ALDH3B1 (3)
- ALDH4A1 (3)
- ALDOB (3)
- ALK (3)
- APC (3)
- APLNR (3)
- APP (3)
- AQP3 (3)
- ARRB1 (3)
- BCL2L11 (3)
- BLNK (3)
- BMP3 (3)
- BMX (3)
- BRCA1 (3)
- BSG (3)
- CAMK2B (3)
- CASP1 (3)
- CCND1 (3)
- CCND3 (3)
- CCR6 (3)
- CDK5 (3)
- CDKN1A (3)
- CDKN2A (3)
- CDKN2C (3)
- CFTR (3)
- CIDEB (3)
- CREB1 (3)
- CSNK1A1 (3)
- CXCR4 (3)
- CYP19A1 (3)
- DNMT1 (3)
- DUSP6 (3)
- EIF2AK3 (3)
- FASLG (3)
- FGFR2 (3)
- FOS (3)
- GAB2 (3)
Reactivities
- Human (3209)
- Mouse (2553)
- Rat (2031)
- Monkey (43)
- Bovine (32)
- Dog (24)
- Chicken (18)
- Gorilla (17)
- Pig (14)
- Gibbon (12)
- Rabbit (12)
- Xenopus (11)
- Horse (9)
- Chimpanzee (8)
- X. tropicalis (8)
- Hamster (6)
- Rhesus Monkey (6)
- Zebrafish (6)
- Orang-Utan (5)
- Bat (4)
- Guinea Pig (3)
- Primate (3)
- Cow (2)
- Porcine (2)
- Sheep (2)
- Feline (1)
- Ferret (1)
- Goat (1)
- Mink (1)
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Pathways
- Pathways in cancer (328)
- Metabolic pathways (259)
- MAPK signaling pathway (239)
- Focal adhesion (177)
- Neurotrophin signaling pathway (160)
- Chemokine signaling pathway (154)
- Cytokine-cytokine receptor interaction (146)
- Neuroactive ligand-receptor interaction (143)
- Regulation of actin cytoskeleton (135)
- Prostate cancer (131)
- ErbB signaling pathway (130)
- Insulin signaling pathway (121)
- Apoptosis (120)
- Toll-like receptor signaling pathway (118)
- Cell cycle (115)
- T cell receptor signaling pathway (113)
- Chronic myeloid leukemia (112)
- Colorectal cancer (111)
- Jak-STAT signaling pathway (111)
- Pancreatic cancer (105)
- Progesterone-mediated oocyte maturation (105)
- Wnt signaling pathway (104)
- Acute myeloid leukemia (96)
- Calcium signaling pathway (95)
- Oocyte meiosis (93)
- Small cell lung cancer (92)
- Renal cell carcinoma (89)
- Alzheimer's disease (88)
- GnRH signaling pathway (87)
- Glioma (86)
- Melanoma (84)
- p53 signaling pathway (83)
- Adipocytokine signaling pathway (82)
- Axon guidance (82)
- B cell receptor signaling pathway (82)
- Natural killer cell mediated cytotoxicity (82)
- Endocytosis (81)
- Endometrial cancer (81)
- Fc gamma R-mediated phagocytosis (78)
- Non-small cell lung cancer (78)
- VEGF signaling pathway (76)
- Fc epsilon RI signaling pathway (73)
- Leukocyte transendothelial migration (73)
- Melanogenesis (72)
- Vascular smooth muscle contraction (70)
- Long-term potentiation (69)
- Amyotrophic lateral sclerosis (ALS) (65)
- Huntington's disease (64)
- TGF-beta signaling pathway (63)
- Gap junction (61)
- Adherens junction (60)
- NOD-like receptor signaling pathway (60)
- Epithelial cell signaling in Helicobacter pylori infection (59)
- Tight junction (58)
- mTOR signaling pathway (58)
- Bladder cancer (56)
- Ubiquitin mediated proteolysis (55)
- Type II diabetes mellitus (53)
- Long-term depression (48)
- RIG-I-like receptor signaling pathway (48)
- Cell adhesion molecules (CAMs) (44)
- Dilated cardiomyopathy (44)
- Glycolysis / Gluconeogenesis (43)
- Purine metabolism (42)
- Hematopoietic cell lineage (41)
- Complement and coagulation cascades (37)
- ECM-receptor interaction (36)
- Hypertrophic cardiomyopathy (HCM) (35)
- Parkinson's disease (34)
- Lysosome (33)
- Phosphatidylinositol signaling system (33)
- Thyroid cancer (33)
- Basal cell carcinoma (32)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (31)
- Pathogenic Escherichia coli infection (31)
- Notch signaling pathway (30)
- PPAR signaling pathway (30)
- Viral myocarditis (30)
- Hedgehog signaling pathway (28)
- Metabolism of xenobiotics by cytochrome P450 (28)
- Drug metabolism - cytochrome P450 (26)
- Type I diabetes mellitus (25)
- Arginine and proline metabolism (24)
- Cytosolic DNA-sensing pathway (24)
- ABC transporters (23)
- Prion diseases (22)
- Alanine (21)
- Fructose and mannose metabolism (21)
- Retinol metabolism (21)
- Vibrio cholerae infection (21)
- aspartate and glutamate metabolism (21)
- Antigen processing and presentation (20)
- Glycerolipid metabolism (20)
- Pyruvate metabolism (20)
- Taste transduction (20)
- Fatty acid metabolism (19)
- Butanoate metabolism (18)
- Inositol phosphate metabolism (18)
- Valine (18)
- Base excision repair (17)
- Tyrosine metabolism (17)
- Arachidonic acid metabolism (16)
- Renin-angiotensin system (16)
- SNARE interactions in vesicular transport (16)
- leucine and isoleucine degradation (16)
- Androgen and estrogen metabolism (15)
- Cysteine and methionine metabolism (15)
- Galactose metabolism (15)
- Homologous recombination (15)
- Olfactory transduction (15)
- Primary immunodeficiency (15)
- Autoimmune thyroid disease (14)
- Pentose phosphate pathway (14)
- Graft-versus-host disease (13)
- Histidine metabolism (13)
- Mismatch repair (13)
- Systemic lupus erythematosus (13)
- Tryptophan metabolism (13)
- Allograft rejection (12)
- Cardiac muscle contraction (12)
- Starch and sucrose metabolism (12)
- Dorso-ventral axis formation (11)
- Glutathione metabolism (11)
- Regulation of autophagy (11)
- Sphingolipid metabolism (11)
- Citrate cycle (TCA cycle) (10)
- DNA replication (10)
- Non-homologous end-joining (10)
- Propanoate metabolism (10)
- Pyrimidine metabolism (10)
- beta-Alanine metabolism (10)
- Amino sugar and nucleotide sugar metabolism (9)
- C21-Steroid hormone metabolism (9)
- Linoleic acid metabolism (9)
- Nucleotide excision repair (9)
- Drug metabolism - other enzymes (8)
- Maturity onset diabetes of the young (8)
- Nitrogen metabolism (8)
- Phenylalanine metabolism (8)
- Glycerophospholipid metabolism (7)
- Lysine degradation (7)
- Primary bile acid biosynthesis (7)
- RNA degradation (7)
- Ascorbate and aldarate metabolism (6)
- Folate biosynthesis (6)
- Other glycan degradation (6)
- Pentose and glucuronate interconversions (6)
- Porphyrin and chlorophyll metabolism (6)
- Proteasome (6)
- Riboflavin metabolism (6)
- Ribosome (6)
- Limonene and pinene degradation (5)
- Oxidative phosphorylation (5)
- Pantothenate and CoA biosynthesis (5)
- Taurine and hypotaurine metabolism (5)
- Terpenoid backbone biosynthesis (5)
- Asthma (4)
- Fatty acid biosynthesis (4)
- Glycosaminoglycan degradation (4)
- Nicotinate and nicotinamide metabolism (4)
- Selenoamino acid metabolism (4)
- leucine and isoleucine biosynthesis (4)
- Basal transcription factors (3)
- Biosynthesis of unsaturated fatty acids (3)
- Circadian rhythm - mammal (3)
- Glycine (3)
- Steroid biosynthesis (3)
- serine and threonine metabolism (3)
- Aminoacyl-tRNA biosynthesis (2)
- Caffeine metabolism (2)
- Ether lipid metabolism (2)
- Glyoxylate and dicarboxylate metabolism (2)
- Methane metabolism (2)
- Synthesis and degradation of ketone bodies (2)
- Vitamin B6 metabolism (2)
- alpha-Linolenic acid metabolism (2)
- Chondroitin sulfate biosynthesis (1)
- D-Glutamine and D-glutamate metabolism (1)
- Glycosphingolipid biosynthesis - ganglio series (1)
- Glycosphingolipid biosynthesis - globo series (1)
- One carbon pool by folate (1)
- Phenylalanine (1)
- Spliceosome (1)
- Sulfur metabolism (1)
- Thiamine metabolism (1)
- Ubiquinone and other terpenoid-quinone biosynthesis (1)
- tyrosine and tryptophan biosynthesis (1)