Antibodies

View as table Download

Rabbit anti-RUVBL1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human RUVBL1

CCND1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CCND1

Rabbit anti-TP53 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TP53

Anti-CCND1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Rabbit polyclonal p53 (Ab-15) antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human p53 around the phosphorylation site of Serine 15.

Rabbit polyclonal p53 (Phospho-Ser15) antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human p53 around the phosphorylation site of Serine 15 (P-L-SP-Q-E).
Modifications Phospho-specific

Rabbit polyclonal MYC antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human Myc.

Rabbit Polyclonal c-Myc Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to the human c-Myc protein (between residues 400-450) [UniProt P01106]

Rabbit Polyclonal Antibody against TP53 (T55)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This p53 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-62 amino acids from human p53.

Rabbit polyclonal Phospho-p53(T18) Antibody

Applications Dot, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This p53 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T18 of human p53.
Modifications Phospho-specific

Rabbit polyclonal p53 Antibody (S315)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This p53 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 293-322 amino acids from human p53.

Rabbit Polyclonal C-myc antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human C-myc

Rabbit polyclonal p53 (Phospho-Thr387) antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human p53 around the phosphorylation site of threonine 387 (F-K-TP-E-G).
Modifications Phospho-specific

Rabbit Polyclonal anti-TP53 antibody

Applications Assay, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE

Rabbit Polyclonal anti-TP53 antibody

Applications Assay, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE

Rabbit Polyclonal Antibody against MYC (T58)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This MYC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 36-65 amino acids from human MYC.

Rabbit polyclonal Phospho-p53(S20) Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This p53 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S20 of human p53.
Modifications Phospho-specific

Rabbit Polyclonal p53 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human p53.

Rabbit Polyclonal Anti-CTBP2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CTBP2 antibody: synthetic peptide directed towards the C terminal of human CTBP2. Synthetic peptide located within the following region: TGRIPESLRNCVNKEFFVTSAPWSVIDQQAIHPELNGATYRYPPGIVGVA

Rabbit Polyclonal Anti-CTBP2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CTBP2 antibody: synthetic peptide directed towards the middle region of human CTBP2. Synthetic peptide located within the following region: APGGLPAAMEGIIPGGIPVTHNLPTVAHPSQAPSPNQPTKHGDNREHPNE

Rabbit anti p53 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the N-terminus of human p53 protein

Rabbit anti P53(pS15) Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the epitope –PLSQE- at a phosphorylation site at serine 15 of human p53 protein

Rabbit anti P53(pS37) Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the epitope –LPSPH- at a phosphorylation site at serine 37 of human p53 protein

Anti-CCND1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 255-270 amino acids of Human Cyclin D1

Anti-CTBP2 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human C-terminal binding protein 2

Anti-CTBP2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human C-terminal binding protein 2

Rabbit Polyclonal Anti-CTBP2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CTBP2