Antibodies

View as table Download

Rabbit polyclonal EGFR (Ab-1172) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q).

Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA

Rabbit polyclonal SMAD3-S208 Antibody

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This SMAD3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from human SMAD3.

Rabbit polyclonal EGFR (Thr693) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human: Thr693, Mouse: Thr695, Rat: Thr694
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of threonine 693 (P-L-TP-P-S).
Modifications Phospho-specific

Rabbit polyclonal SMAD3 phospho S423/phospho S425 antibody

Applications IHC, WB
Reactivities Human, Zebrafish, Rat, Mouse, Swine, Bovine, Chicken
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 417-425 of human SMAD3 protein.

Anti-SMAD3 (Phospho-Ser425) Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of serine 425 (C-S-S-V-S(p)) derived from Human Smad3.
Modifications Phospho-specific

Rabbit Polyclonal anti-GLI2 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GLI2 antibody: synthetic peptide directed towards the N terminal of human GLI2. Synthetic peptide located within the following region: RNDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCLHVRAIKTE

Rabbit Polyclonal Anti-WNT7B Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT7B antibody: synthetic peptide directed towards the middle region of human WNT7B. Synthetic peptide located within the following region: WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM

Rabbit polyclonal Smad3 (Ab-204) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Smad3 around the phosphorylation site of serine 204 (A-G-SP-P-N).

Rabbit polyclonal anti-WNT1 antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human WNT1.

Rabbit polyclonal anti-EGFR antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This whole rabbit serum was prepared by repeated immunizations with a peptide synthesized using conventional technology. The sequence of the epitope maps to a region near the carboxy terminus which is identical in human, mouse and rat EGFR.

Rabbit polyclonal EGFR Antibody (S1070)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This EGFR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1048-1077 amino acids from human EGFR.

Rabbit Polyclonal Wnt-5a Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to amino acids 190-230 of human Wnt5A was used as the immunogen for this antibody, GenBank no NP_003383.2.

Rabbit anti-SMAD3 (Phospho-Ser425) polyclonal antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antibody was produced against synthesized phosphopeptide derived from humanSmad3 around the phosphorylation site of serine 425 (C-S-S-V-SP).
Modifications Phospho-specific

Rabbit polyclonal anti-GLI-3 antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human GLI-3.

Rabbit polyclonal anti-SMAD3 antibody

Applications IHC, WB
Reactivities Human, Xenopus, Xenopus Tropicalis, Zebrafish, Rat, Mouse, Swine, Bovine, Chicken
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to the C-terminal domain of human SMAD3 protein.

Anti-SMAD2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around aa.218~222 (P-E-T-P-P) derived from Human Smad2.

Anti-SMAD3 Rabbit Polyclonal Antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around aa.423~427 (C-S-S-V-S) derived from Human Smad3.

WNT6 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Gibbon, Bovine, Dog, Gorilla, Horse, Human, Rabbit
Conjugation Unconjugated
Immunogen WNT6 antibody was raised against synthetic 18 amino acid peptide from internal region of human WNT6. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Elephant, Bovine, Dog, Bat, Horse, Rabbit, Opossum (100%); Marmoset, Mouse, Rat, Hamster, Platypus (94%); Turkey, Chicken (83%).

Anti-BMP4 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 293-408 amino acids of human bone morphogenetic protein 4

Anti-BMP4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 293-408 amino acids of human bone morphogenetic protein 4

Rabbit Polyclonal Anti-WNT3A Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human WNT3A

Rabbit Polyclonal Anti-WNT1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human WNT1

Rabbit Polyclonal Anti-SMAD3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SMAD3

Rabbit Polyclonal Anti-WNT2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human WNT2

Rabbit Polyclonal Anti-WNT6 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human WNT6

Rabbit Polyclonal Anti-WNT8B Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human WNT8B