Antibodies

Jump to Filters
View as table Download
MMP3 Rabbit Polyclonal Antibody
TA346323

USD 475.00

5 Days

Rabbit Polyclonal Anti-MMP3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MMP3 antibody: synthetic peptide directed towards the middle region of human MMP3. Synthetic peptide located within the following region: SFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTN
MMP3 Rabbit Polyclonal Antibody
TA346324

USD 475.00

5 Days

Rabbit Polyclonal Anti-MMP3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MMP3 antibody: synthetic peptide directed towards the middle region of human MMP3. Synthetic peptide located within the following region: AEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLN
MMP3 Rabbit Polyclonal Antibody
AP22793PU-N

USD 540.00

2 Weeks

MMP3 rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Equine, Human, Mouse, Rabbit, Rat
Immunogen Synthetic peptide surrounding amino acid 465 of Rat MMP-3
MMP3 Rabbit Polyclonal Antibody
TA590687

USD 409.00

In Stock

Rabbit Polyclonal MMP3 Antibody

Applications ELISA, IHC, WB
Reactivities Human
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.
MMP3 Rabbit Polyclonal Antibody
TA336495

USD 457.00

5 Days

Rabbit Polyclonal MMP-3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an C-terminal portion of the human MMP3 protein (between residues 400-477) [UniProt P08254]
MMP3 (1-35) Rabbit Polyclonal Antibody
AP23149PU-N

USD 468.00

5 Days

MMP3 rabbit polyclonal antibody, Immunoaffinity purified

Applications ICC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Carrier-protein conjugated synthetic peptide encompassing a sequence within the N-terminus region of human MMP3. The exact sequence is proprietary.
MMP3 Rabbit Polyclonal Antibody
TA313102

USD 345.00

4 Weeks

Rabbit polyclonal anti-MMP-3 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human MMP-3.
MMP3 Rabbit Polyclonal Antibody
TA323014

USD 345.00

In Stock

Anti-MMP3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 350 amino acids of Human Matrix metalloproteinase-3