Rabbit anti-NFKBIB Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NFKBIB |
Rabbit anti-NFKBIB Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NFKBIB |
Anti-PAK1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 225-238 amino acids of Human p21 protein (Cdc42/Rac)-activated kinase |
Rabbit polyclonal LCK Antibody (N-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This LCK antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 23-52 amino acids from the N-terminal region of human LCK. |
Rabbit polyclonal PAK1 (Ab-204) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PAK1 around the phosphorylation site of serine 204 (T-R-SP-V-I). |
Rabbit polyclonal PAK1 (Phospho-Ser199) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PAK1/2 around the phosphorylation site of serine 199 (T-K-SP-V-Y). |
Modifications | Phospho-specific |
Rabbit polyclonal PAK1 (Phospho-Ser204) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PAK1 around the phosphorylation site of serine 204 (T-R-SP-V-I). |
Modifications | Phospho-specific |
Rabbit polyclonal PAK1/2 (Ab-199) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PAK1/2 around the phosphorylation site of serine 199 (T-K-SP-V-Y). |
PAK1 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Rabbit polyclonal IkB-beta (Ser23) antibody(Phospho-specific)
Applications | IF, IHC, WB |
Reactivities | Human: Ser23, Mouse: Ser23, Rat: Ser23 |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human I?B-β around the phosphorylation site of serine 23. |
Modifications | Phospho-specific |
Rabbit polyclonal PAK3 (Ser154) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PAK3 around the phosphorylation site of serine 154 (Y-M-SP-F-T). |
Modifications | Phospho-specific |
Anti-PAK1 (Phospho-Thr212) Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around phosphorylation site of threonine 212 (P-V-T(p)-P-T) derived from Human PAK1. |
Modifications | Phospho-specific |
Rabbit polyclonal LCK Antibody (C-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This LCK antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 480-509 amino acids from the C-terminal region of human LCK. |
Rabbit polyclonal PAK1/2/3 (Phospho-Thr423/402/421) antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PAK1/2/3 around the phosphorylation site of threonine 423/402/421 (R-S-TP-M-V). |
Modifications | Phospho-specific |
PAK1 pThr423/402/421 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PAK1 around the phosphorylation site of threonine 423 (R-S-TP-M-V). |
PAK1 pThr423/402/421 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PAK1 around the phosphorylation site of threonine 423 (R-S-TP-M-V). |
PAK1 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PAK1around the phosphorylation site of threonine 423 (R-S-Tp-M-V). |
PAK1 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PAK1around the phosphorylation site of threonine 423 (R-S-Tp-M-V). |
PAK1 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 400-450 of Human PAK1. |
PAK1 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
PAK1 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
PAK3 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
PAK1 (245-490) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | Recombinant protein fragment containing a sequence corresponding to a region within amino acids 245 and 490 of Human PAK1 |
Rabbit Polyclonal Anti-NFKBIB Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-NFKBIB Antibody: synthetic peptide directed towards the C terminal of human NFKBIB. Synthetic peptide located within the following region: MLRPNPILARLLRAHGAPEPEGEDEKSGPCSSSSDSDSGDEGDEYDDIVV |
PAK1 rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
PAK1 pThr423/402 rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Anti-NFKBIB (Phospho-Ser23) Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around phosphorylation site of serine 23 (L-G-S(p)-L-G) derived from Human I?B-β. |
Modifications | Phospho-specific |
Anti-PTPN6 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 244-515 amino acids of human protein tyrosine phosphatase, non-receptor type 6 |
Anti-PAK1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 225-238 amino acids of Human p21 protein (Cdc42/Rac)-activated kinase |
Rabbit Polyclonal Anti-PAK3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PAK3 |