Antibodies

Jump to Filters
View as table Download
ABO Rabbit Polyclonal Antibody
TA327092

USD 275.00

3 Weeks

ABO Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ABO
B4GALT3 Rabbit Polyclonal Antibody
TA314795

USD 345.00

In Stock

Rabbit polyclonal anti-B4GALT3 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human B4GALT3.
FUT4 (C-term) Rabbit Polyclonal Antibody
AP51738PU-N

USD 450.00

2 Weeks

FUT4 (C-term) rabbit polyclonal antibody, Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 502-530 amino acids from the C-terminal region of Human Fucosyltransferase 4
B3GALT2 Rabbit Polyclonal Antibody
TA314797

USD 345.00

4 Weeks

Rabbit polyclonal anti-B3GALT2 antibody

Applications IF, IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human B3GALT2.
B3GALT2 Rabbit Polyclonal Antibody
TA338206

USD 375.00

5 Days

Rabbit Polyclonal Anti-B3galt2 Antibody

Applications IHC, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-B3galt2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: RVDPVPPPNEFVFNHWRVSYSSCKYSHLITSHQFQPSELIKYWNHLQQNK
ST3GAL4 Rabbit Polyclonal Antibody
TA339036

USD 375.00

5 Days

Rabbit Polyclonal Anti-ST3GAL4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ST3GAL4 antibody: synthetic peptide directed towards the middle region of human ST3GAL4. Synthetic peptide located within the following region: FDPKVENNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDV
FT1A (FUT6) (N-term) Rabbit Polyclonal Antibody
AP51740PU-N

USD 450.00

2 Weeks

FT1A (FUT6) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 19-49 amino acids from the N-terminal region of Human Fucosyltransferase 6
GCNT2 (C-term) Rabbit Polyclonal Antibody
AP51803PU-N

USD 450.00

2 Weeks

GCNT2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen conjugated synthetic peptide between 371-399 amino acids from the C-terminal region of Human GCNT2 / NACGT1
B3GNT3 Rabbit Polyclonal Antibody
TA308090

USD 415.00

5 Days

Rabbit Polyclonal antibody to B3GNT3 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 122 and 338 of B3GNT3 (Uniprot ID#Q9Y2A9)
ABO Rabbit Polyclonal Antibody
TA351008

USD 345.00

In Stock

Rabbit Polyclonal Anti-ABO Antibody

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ABO
Galactoside 2 alpha L fucosyltransferase 1 (FUT1) Rabbit Polyclonal Antibody
TA351200

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-FUT1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human FUT1