Antibodies

View as table Download

Rabbit Polyclonal Anti-Angiotensin II Receptor Type-1 (extracellular)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide NSSTEDGIKRIQDDC, corresponding to amino acid residues 4-18 of human AT1 receptor. Extracellular, N-terminus.

Rabbit monoclonal antibody against CD13(clone EPR4058)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal AGTR1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen AGTR1 antibody was raised against a 16 amino acid peptide from near the center of human AGTR1.

Rabbit Polyclonal CD10 Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit Polyclonal MAS1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Primate, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human MAS1 protein (between residues 75-125) [UniProt P04201]

Rabbit anti-ANPEP Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ANPEP

Rabbit Polyclonal AGTR2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen AGTR2 antibody was raised against a 16 amino acid peptide from near the center of human AGTR2.

Rabbit polyclonal Neprilysin Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This Neprilysin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 506-534 amino acids from the C-terminal region of human Neprilysin.

Rabbit anti-MME Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MME

Rabbit Polyclonal Aminopeptidase A/APA Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Anti-AGT Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 34-41 amino acids of human angiotensinogen (serpin peptidase inhibitor, clade A, member 8)

Rabbit Polyclonal ACE2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen ACE2 antibody was raised against a synthetic peptide corresponding to amino acids near the center of human ACE2.

Rabbit Polyclonal ACE2 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen ACE2 antibody was raised against a synthetic peptide corresponding to amino acids near the C-terminus of human ACE2.

Rabbit Polyclonal ACE2 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen ACE2 antibody was raised against a synthetic peptide corresponding to amino acids near the N-terminus of human ACE2.

Rabbit Polyclonal ACE2 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen ACE2 antibody was raised against a synthetic peptide corresponding to amino acids near the center of human ACE2.

Rabbit Polyclonal antibody to Angiotensinogen (angiotensinogen (serpin peptidase inhibitor, clade A, member 8))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 476 of Angiotensinogen (Uniprot ID#P01019)

Rabbit Polyclonal Anti-MAS1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAS1 antibody: synthetic peptide directed towards the middle region of human MAS1. Synthetic peptide located within the following region: VIIFIAILSFLVFTPLMLVSSTILVVKIRKNTWASHSSKLYIVIMVTIII

Rabbit polyclonal MME Antibody (Center)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This MME antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 721-747 amino acids from the C-terminal region of human MME.

Rabbit Polyclonal Anti-MAS1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAS1 antibody: synthetic peptide directed towards the middle region of human MAS1. Synthetic peptide located within the following region: RPKYQSALVCALLWALSCLVTTMEYVMCIDREEESHSRNDCRAVIIFIAI

AGTR2 / AT2 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Bovine, Hamster, Human, Monkey, Mouse, Rat, Sheep, Gorilla, Dog, Pig, Horse, Gibbon
Conjugation Unconjugated
Immunogen AGTR2 / AT2 Receptor antibody was raised against synthetic 16 amino acid peptide from internal region of human AGTR2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Sheep, Dog, Bat, Bovine, Hamster, Elephant, Panda, Horse, Pig (100%).

Anti-AGT Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 34-43 amino acids of human angiotensinogen (serpin peptidase inhibitor, clade A, member 8)

Anti-AGT Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 34-43 amino acids of human angiotensinogen (serpin peptidase inhibitor, clade A, member 8)

Anti-AGTR2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 349-363 amino acids of human angiotensin II receptor, type 2

Anti-MME Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 519-533 amino acids of human membrane metallo-endopeptidase

Anti-MME Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 519-533 amino acids of human membrane metallo-endopeptidase

Anti-ACE2 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 556-740 amino acids of human angiotensin I converting enzyme (peptidyl-dipeptidase A) 2

Anti-ACE2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 185-199 amino acids of Human Angiotensin-converting enzyme 2

Anti-ACE2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 185-199 amino acids of Human Angiotensin-converting enzyme 2

Rabbit Polyclonal Anti-REN Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human REN

Rabbit Polyclonal Anti-MAS1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MAS1

Rabbit Polyclonal Anti-ANPEP Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ANPEP

Rabbit Polyclonal Anti-ACE Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ACE