ATG16L1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ATG16L1 |
ATG16L1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ATG16L1 |
Rabbit anti-ATG16L1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ATG16L1 |
Rabbit polyclonal ATG16L Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This ATG16L antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 161-190 amino acids from human ATG16L. |
ATG16L1 (N-term) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | ATG16L1 antibody was raised against 18 amino acid peptide from near the amino terminus of human ATG16 |
ATG16L1 rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | ATG16L1 antibody was raised against 18 amino acid peptide from near the center of human ATG16 |
Rabbit Polyclonal Anti-ATG16L1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ATG16L1 Antibody: synthetic peptide directed towards the N terminal of human ATG16L1. Synthetic peptide located within the following region: QYNKLLEKSDLHSVLAQKLQAEKHDVPNRHEISPGHDGTWNDNQLQEMAQ |
ATG16L1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ATG16L1 |
ATG16L1 Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human ATG16L1 (NP_110430.5). |
Modifications | Unmodified |