Rabbit Polyclonal Anti-CHP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHP antibody: synthetic peptide directed towards the N terminal of human CHP. Synthetic peptide located within the following region: FTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFM |
AKT1 (C-term) rabbit polyclonal antibody, Serum
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Chicken, Human, Mouse, Rat |
| Immunogen | Synthetic peptide -KLH conjugated corresponding to the C-terminus (460-480) of Human, Rat, Mouse and Chicken AKT proteins conjugated to KLH using maleimide. |
USD 450.00
2 Weeks
Rabbit polyclonal Raf1 (Ab-621) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human RAF1 around the phosphorylation site of serine 621 (S-A-S-E-P). |
Rabbit polyclonal Akt (Ab-129) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Akt around the phosphorylation site of serine 129 (D-N-SP-G-A). |
Rabbit polyclonal Akt (Ab-326) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Akt around the phosphorylation site of tyrosine 326 (N-D-YP-G-R). |
USD 345.00
In Stock
Rabbit polyclonal anti-PA2G6 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human PA2G6. |
Rabbit Polyclonal Akt (Thr308) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Akt around the phosphorylation site of Threonine 308 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Caspase 9 (Thr125) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Caspase 9 around the phosphorylation site of Threonine 125 |
| Modifications | Phospho-specific |
Rabbit Polyclonal NFAT4 (Ser165) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NFAT4 around the phosphorylation site of Serine 165 |
| Modifications | Phospho-specific |
Rabbit Polyclonal eNOS Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human eNOS. |
Rabbit Polyclonal Src (Tyr418) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Src around the phosphorylation site of Tyrosine 418 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Src (Tyr529) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Src around the phosphorylation site of Tyrosine 529 |
| Modifications | Phospho-specific |
AKT2 Rabbit Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human AKT2 |
Rabbit anti-Phospho-AKT1/2/3-Y315/316/312 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding Y315/316/312 of human AKT1/AKT2/AKT3 |
Rabbit anti-MAPK14 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human MAPK14 |
Rabbit anti-VEGFA Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human VEGFA |
Rabbit anti-PRKCB Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PRKCB |
Rabbit Polyclonal Anti-PLA2G5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PLA2G5 antibody: synthetic peptide directed towards the middle region of human PLA2G5. Synthetic peptide located within the following region: YRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILC |
Rabbit Polyclonal Anti-PI3 kinase P110a Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PI3 kinase P110a Antibody: A synthesized peptide derived from human PI3 kinase P110a |
Rabbit Polyclonal Anti-VEGF Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VEGF Antibody: Synthetic peptide corresponding to a region derived human vascular endothelial growth factor A |
Rabbit Polyclonal Anti-Caspase 9 (Cleaved-Asp353) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Caspase 9 (Cleaved-Asp353) Antibody: A synthesized peptide derived from human Caspase 9 (Cleaved-Asp353) |
Rabbit Polyclonal Anti-Phospho-VEGFR2(Tyr1214) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Phospho-VEGFR2(Tyr1214) Antibody: A synthesized peptide derived from human VEGFR2 around the phosphorylation site of Tyrosine 1214 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-Phospho-p38 MAPK (Thr180/Tyr182) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Phospho-p38 MAPK (Thr180/Tyr182) Antibody: A synthesized peptide derived from human p38 MAPK around the phosphorylation site of Thr180/Tyr182) . |
| Modifications | Phospho-specific |
MEK1 (MAP2K1) (N-term) rabbit polyclonal antibody, Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Xenopus |
| Immunogen | MAP2K1 antibody was raised against synthetic peptide derived from sequence near the amino-terminus of human MEK1, conjugated to KLH |
Rabbit Polyclonal Antibody against VEGFA
| Applications | WB |
| Reactivities | Human, Mouse, Dog, Horse, Cow, Rat, Chicken, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the human VEGFA protein sequence (between residues 150-250). [Swiss-Prot# P15692] |
USD 450.00
In Stock
Rabbit Polyclonal Antibody against PIK3CG (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KCG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 518-547 amino acids from the Central region of human PI3KCG. |
Rabbit Polyclonal antibody to PIK3R3 (phosphoinositide-3-kinase, regulatory subunit 3 (gamma))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 192 and 427 of PIK3R3 |
Rabbit polyclonal NFAT3 (Ab-676) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human NFAT3 around the phosphorylation site of serine 676 (K-R-SP-P-T). |
Rabbit polyclonal AKT1/2/3 (Ab-315/316/312) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human AKT1/2/3 around the phosphorylation site of tyrosine 315/316/312 (P-E-YP-L-A). |
Rabbit polyclonal Caspase 9 (Thr125) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Caspase 9 around the phosphorylation site of threonine 125 (P-E-TP-P-R). |
| Modifications | Phospho-specific |
Rabbit polyclonal Src (Tyr529) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Src around the phosphorylation site of tyrosine 529 (P-Q-YP-Q-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal MAPKAPK2 (Ab-272) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human MAPKAPK2 around the phosphorylation site of serine 272 (A-I-SP-P-G). |
Rabbit polyclonal MAPKAPK2 (Ser272) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MAPKAPK2 around the phosphorylation site of serine 272 (A-I-SP-P-G). |
| Modifications | Phospho-specific |
Rabbit polyclonal Raf1 (Tyr341) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Raf1 around the phosphorylation site of tyrosine 341 (S-Y-YP-W-E). |
| Modifications | Phospho-specific |
Rabbit polyclonal PLCG1 (Ab-771) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PLCG1 around the phosphorylation site of tyrosine 771 (P-D-Y-G-A). |
Rabbit polyclonal Akt (Thr450) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human AKT1 around the phosphorylation site of threonine 450 (T-I-TP-P-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal eNOS (Ser615) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human eNOS around the phosphorylation site of serine 615 (F-N-SP-I-S). |
| Modifications | Phospho-specific |
Germany
Japan
United Kingdom
China
