Rabbit Polyclonal IFN-beta Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
Rabbit polyclonal IL8 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-99 amino acids from the C-terminal region of human IL8. |
Rabbit anti-MAVS Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MAVS |
Rabbit anti-IFNB1 Polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IFNB1 |
Rabbit Polyclonal Anti-Interleukin 8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Interleukin 8 Antibody: A synthesized peptide derived from human Interleukin 8 |
Rabbit Polyclonal Anti-MAVS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAVSantibody: synthetic peptide directed towards the C terminal of human VISA. Synthetic peptide located within the following region: VAENPSIQLLEGNPGPPADPDGGPRPQADRKFQEREVPCHRPSPGALWLQ |
Rabbit Polyclonal Anti-MAVS Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAVSantibody: synthetic peptide directed towards the N terminal of human VISA. Synthetic peptide located within the following region: ETQAPESPGENSEQALQTLSPRAIPRNPDGGPLESSSDLAALSPLTSSGH |
Rabbit Polyclonal Anti-IFNK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IFNK antibody is: synthetic peptide directed towards the C-terminal region of Human IFNK. Synthetic peptide located within the following region: MKPSEARVPQLSSLELRRYFHRIDNFLKEKKYSDCAWEIVRVEIRRCLYY |
Rabbit polyclonal anti-IP-10 antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | E. coli-expressed recombinant rat IP-10 |
Rabbit Polyclonal Anti-IFNE Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IFNE Antibody is: synthetic peptide directed towards the middle region of Human IFNE. Synthetic peptide located within the following region: IFSLFRANISLDGWEENHTEKFLIQLHQQLEYLEALMGLEAEKLSGTLGS |
Germany
Japan
United Kingdom
China
