Antibodies

View as table Download

Angpt2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to a sequence mapping near the C-terminal  (454-468) of Human Angiopoietin-2.

Rabbit Polyclonal Anti-ANGPT2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Angpt2 antibody is: synthetic peptide directed towards the middle region of Mouse Angpt2. Synthetic peptide located within the following region: NQTTRLELQLLQHSISTNKLEKQILDQTSEINKLQNKNSFLEQKVLDMEG

Rabbit anti-ANGPT2 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ANGPT2

Rabbit Polyclonal Anti-ANG 2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ANG 2 Antibody: A synthesized peptide derived from human ANG 2

Angiopoietin 2 (ANGPT2) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 409-440 amino acids from the C-terminal region of human ANGPT2

Rabbit Polyclonal ANGPT2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ANGPT2 antibody was raised against an 18 amino acid synthetic peptide near the carboxy terminus of human ANGPT2.

Rabbit polyclonal Angiopoietin 2 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This whole rabbit serum was prepared by repeated immunizations with a synthetic peptide, corresponding to a region near the N-terminus of mouse angiopoietin-2 protein, conjugated to KLH using maleimide.

Anti-ANGPT2 rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human angiopoietin 2

ANGPT2 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human ANGPT2