Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal ECSIT Antibody (C-term)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ECSIT antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 396-425 amino acids from the C-terminal region of human ECSIT. |
Rabbit Polyclonal Anti-Ecsit Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Ecsit antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: EPWLVPRPPEPQRKPIKVPAMHEDSFKPSGNRERDKASFLNAVRSFGAHN |
Rabbit Polyclonal Anti-Ecsit Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SITPEC antibody: synthetic peptide directed towards the middle region of mouse SITPEC. Synthetic peptide located within the following region: KVTVYQMSLPSDSTGMEDPTQPHIVGIQSPDQQAALARHNPSRPVFVEGP |
ECSIT Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human ECSIT |
ECSIT rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ECSIT |
ECSIT Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 50-296 of human ECSIT (NP_001135936.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- ECSIT
Applications
- WB
Antibody Hosts
- Rabbit