Antibodies

View as table Download

B1R / BDKRB1 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen B1R / BDKRB1 antibody was raised against synthetic 16 amino acid peptide from 1st cytoplasmic domain of human BDKRB1. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (94%); Horse (81%).

Rabbit Polyclonal Anti-CHRM1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CHRM1

Rabbit Polyclonal Anti-CYSLTR1 Antibody (C-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen CYSLTR1 / CYSLT1 antibody was raised against synthetic 20 amino acid peptide from C-terminus of human CYSLTR1 / CYSLT1. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey, Marmoset (95%); Gibbon, Mouse, Panda (90%); Rat, Bovine, Elephant, Rabbit, Pig (85%).

Dopamine Receptor D1 / DRD1 Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Gorilla, Human
Conjugation Unconjugated
Immunogen DRD1 / Dopamine Receptor D1 antibody was raised against synthetic 20 amino acid peptide from 2nd extracellular domain of human DRD1. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon, Marmoset (95%); Elephant (90%); Dog, Rabbit (85%); Horse (80%).

Rabbit polyclonal anti-PE2R3 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PE2R3.

Rabbit polyclonal anti-EDNRA antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human EDNRA.

Rabbit Polyclonal Anti-CHRM1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CHRM1

Rabbit Polyclonal Endothelin B Receptor Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit polyclonal anti-BDKRB1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human BDKRB1.
Modifications Phospho-specific

Rabbit polyclonal anti-EDNRA antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human EDNRA.

ADRB3 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen ADRB3 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human ADRB3. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Monkey (94%).

Rabbit polyclonal anti-CCKBR antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CCKBR.

Rabbit polyclonal anti-CHRM2 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CHRM2.

Rabbit polyclonal anti-ADRB2 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ADRB2.

CHRM3 / M3 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human, Monkey, Orang-Utan
Conjugation Unconjugated
Immunogen CHRM3 / M3 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human CHRM3 / M3. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Chimpanzee, Mouse, Rat, Sheep, Hamster, Elephant, Dog, Bovine, Horse, Rabbit, Pig, Guinea pig (95%); Opossum, Turkey, Chicken, Lizard (89%).

B1R / BDKRB1 Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Human, Monkey, Gorilla
Conjugation Unconjugated
Immunogen B1R / BDKRB1 antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human BDKRB1. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon (94%); Rat, Hamster (89%); Mouse, Rabbit, Horse (83%).

Rabbit polyclonal anti-5-HT-2C antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human 5-HT-2C.

Rabbit polyclonal anti-HTR4 antibody

Applications IF, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human HTR4.

Anti-BDKRB2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 377-391 amino acids of human bradykinin receptor B2

Rabbit Polyclonal Anti-ADRB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ADRB1 antibody is: synthetic peptide directed towards the C-terminal region of Human ADRB1. Synthetic peptide located within the following region: SDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV

Rabbit anti-ADRA1D polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH

Rabbit polyclonal anti-PTGER3 antibody

Applications IF
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PTGER3.

Rabbit polyclonal Histamine H1 Receptor (Ser398)(Phospho-specific)

Applications IF
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Histamine H1 Receptor around the phosphorylation site of serine 398 (IS-H-SP-R-Q).
Modifications Phospho-specific

Rabbit polyclonal anti-ADRA1B antibody

Applications IF
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ADRA1B.

Rabbit polyclonal anti-HRH2 antibody

Applications IF
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human HRH2.

Rabbit polyclonal Thrombin Receptor antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Thrombin Receptor.

Rabbit polyclonal F2R / PAR1 (Cleaved-Ser42) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human PAR1.

Rabbit polyclonal anti-5-HT-5A antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human 5-HT-5A.

Rabbit polyclonal anti-CLTR2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CLTR2.

DRD5 / Dopamine Receptor D5 Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen DRD5 / Dopamine Receptor D5 antibody was raised against synthetic 16 amino acid peptide from 3rd extracellular domain of human DRD5 / Dopamine Receptor D5. Percent identity with other species by BLAST analysis: Human (100%); Gorilla (94%); Gibbon, Monkey (88%); Marmoset (81%).

Anti-CHRM2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 208-388 amino acids of human cholinergic receptor, muscarinic 2

Rabbit Polyclonal Adrenergic Receptor beta2 (Ser346) Antibody (Phospho-specific)

Applications WB
Reactivities Human:S346
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Adrenergic Receptor beta2 around the phosphorylation site of Serine 346
Modifications Phospho-specific

Rabbit polyclonal NK1R antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NK1R.

Rabbit Polyclonal Thrombin Receptor Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. In vivo generated recombinant protein fragment.

Anti-AGTR1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 301-359 amino acids of human angiotensin II receptor, type 1angiotensin II receptor, type 1

Anti-GRM1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 31-44 amino acids of Human glutamate receptor, metabotropic 1

Anti-PTAFR Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1-14 amino acids of Human platelet-activating factor receptor

Anti-F2R Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 56-70 amino acids of human coagulation factor II (thrombin) receptor

Anti-GRPR Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 350-365 amino acids of Human gastrin-releasing peptide receptor

Anti-GRPR Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 350-365 amino acids of Human gastrin-releasing peptide receptor

Anti-EDNRB Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 70-84 amino acids of human endothelin receptor type B

Anti-NTSR1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 402-418 amino acids of Human neurotensin receptor 1 (high affinity)

Anti-5HT4 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 45-59 amino acids of Human 5-hydroxytryptamine (serotonin) receptor 4, G protein-coupled

Anti-PTGER1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 399-402 amino acids of Human prostaglandin E receptor 1 (subtype EP1), 42kDa

Anti-ADRA1A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 152-165 amino acids of human adrenoceptor alpha 1A

Anti-ADRA1A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 152-165 amino acids of human adrenoceptor alpha 1A

Anti-ADRB2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 21-33 amino acids of human adrenoceptor beta 2, surface

Anti-ADRB3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 21-33 amino acids of Human adrenoceptor beta 3

Anti-ADRB3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 21-33 amino acids of Human adrenoceptor beta 3