Germany
Japan
United Kingdom
China
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Antibodies
Download
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR094F2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5H8
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E3
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal antibody to MX1 (myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 194 and 475 of MX1 (Uniprot ID#P20591) |
GPR44 / CRTH2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | GPR44 / CRTH2 antibody was raised against synthetic 33 amino acid peptide from N-terminal extracellular domain of human GPR44 / CRTH2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (91%); Dog, Pig (88%); Rabbit (85%); Bovine (82%). |
Rabbit Polyclonal Anti-EGFLAM Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-EGFLAM antibody is: synthetic peptide directed towards the C-terminal region of Human EGFLAM. Synthetic peptide located within the following region: TTAKDGLLLWRGDSPMRPNSDFISLGLRDGALVFSYNLGSGVASIMVNGS |
USD 428.00
In Stock
Rabbit monoclonal anti-S100P antibody for SISCAPA, clone OTIR1F12
| Applications | SISCAPA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-ASSY antibody for SISCAPA, clone OTIR3F5
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-SPTB1 antibody for SISCAPA, clone OTIR2D2
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-SODM antibody for SISCAPA, clone OTIR4G8
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-ANK1 antibody for SISCAPA, clone OTIR3A12
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 428.00
In Stock
Rabbit monoclonal anti-ST13 Antibody, clone OTIR191G8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-POSTN antibody for SISCAPA, clone OTIR1A5
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-TAGL antibody for SISCAPA, clone OTIR1F8
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-B3AT antibody for SISCAPA, clone OTIR5D8
| Applications | SISCAPA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-A2ML1 antibody for SISCAPA, clone OTIR2E11
| Applications | SISCAPA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-COL11 antibody for SISCAPA, clone OTIR1C9
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-SPTN2 antibody for SISCAPA, clone OTIR4E9
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-PML antibody for SISCAPA, clone OTIR1H2
| Applications | SISCAPA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-RFA2 antibody for SISCAPA, clone OTIR2G2
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-HSBP1 antibody for SISCAPA, clone OTIR5C4
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 428.00
In Stock
Rabbit monoclonal anti-EBP2 antibody for SISCAPA, clone OTIR3D2
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-TKT antibody for SISCAPA, clone OTIR4F5
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-RMD3 antibody for SISCAPA, clone OTIR1A2
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-IASPP antibody for SISCAPA, clone OTIR1G11
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-MIME antibody for SISCAPA, clone OTIR4H1
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-PARK7 antibody for SISCAPA, clone OTIR4F10
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-CD5L antibody for SISCAPA, clone OTIR1F12
| Applications | SISCAPA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-S10A2 antibody for SISCAPA, clone OTIR4F6
| Applications | SISCAPA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-FABP4 antibody for SISCAPA, clone OTIR5E9
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Category
-
Antibodies
- Primary Antibodies
Antibody Hosts
- Rabbit
Isotypes
- IgG
Conjugates
- Unconjugated
Availabilities
- In Stock
Filter by
Target Symbol
- EGFR (25)
- MAPT (19)
- AKT1 (18)
- JUN (15)
- EZR (14)
- TP53 (14)
- ATF2 (13)
- BRCA1 (13)
- CD44 (13)
- CHEK1 (13)
- NR3C1 (13)
- RELA (13)
- IRS1 (12)
- BRAF (11)
- EIF4EBP1 (11)
- ESR1 (11)
- FOXO1 (11)
- PDGFRB (11)
- PRKCD (11)
- CREB1 (10)
- GRIN2B (10)
- IKBKG (10)
- MET (10)
- PAK1 (10)
- SRC (10)
- BAD (9)
- FGFR1 (9)
- MAP2K4 (9)
- MAPK14 (9)
- MDM2 (9)
- NFKB1 (9)
- RAF1 (9)
- RPS6KB1 (9)
- BRCA2 (8)
- CASP3 (8)
- CCNB1 (8)
- CDC25A (8)
- CHUK (8)
- CSF1R (8)
- ERBB2 (8)
- FN1 (8)
- GSK3A (8)
- IGF1R (8)
- JAK2 (8)
- MAP2K1 (8)
- MTOR (8)
- NOS3 (8)
- PPP1R1B (8)
- PRKCA (8)
- PTK2 (8)
- PTPN11 (8)
- PXN (8)
- RUNX1 (8)
- SNCA (8)
- STAT5A (8)
- YWHAZ (8)
- ABL1 (7)
- CASP7 (7)
- CASP9 (7)
- CDK2 (7)
- CFLAR (7)
- CTNNB1 (7)
- EPHA2 (7)
- HDAC2 (7)
- HSF1 (7)
- MAPK3 (7)
- NFKBIA (7)
- RPS6KA5 (7)
- SMAD1 (7)
- SOX2 (7)
- STAT1 (7)
- SYK (7)
- AFP (6)
- AGT (6)
- APP (6)
- ATF4 (6)
- BCL2 (6)
- BCL2L1 (6)
- CCNE1 (6)
- CD274 (6)
- CEBPA (6)
- DPYSL2 (6)
- ELK1 (6)
- ERBB3 (6)
- GAB2 (6)
- GCG (6)
- HDAC1 (6)
- HDAC4 (6)
- HSPD1 (6)
- IKBKB (6)
- JUND (6)
- MAPK8 (6)
- MUC1 (6)
- MYB (6)
- NFKB2 (6)
- PAK2 (6)
- POMC (6)
- PRKD1 (6)
- RB1 (6)
- SARS-COV-2 SPIKE PROTEIN (6)
Reactivities
- Human (8865)
- Mouse (6429)
- Rat (4974)
- Bovine (71)
- Monkey (67)
- Dog (50)
- Chicken (35)
- Pig (32)
- Gorilla (21)
- Chimpanzee (20)
- Rhesus Monkey (19)
- Rabbit (17)
- Xenopus (16)
- Gibbon (15)
- X. tropicalis (14)
- Zebrafish (12)
- Hamster (11)
- Horse (11)
- SARS-CoV-2 (11)
- Sheep (8)
- Cow (7)
- Bat (6)
- Guinea Pig (6)
- Orang-Utan (6)
- Feline (4)
- Porcine (4)
- Primate (4)
- Murine (2)
- Drosophila (1)
- Drosophila melanogaster (1)
- Equine (1)
- Escherichia coli (1)
- Ferret (1)
- Fish (1)
- Goat (1)
- Opossum (1)
- Pufferfish (1)
Applications
Clonalities
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (5683)
- Transmembrane (2298)
- Transcription Factors (1274)
- Protein Kinase (884)
- Secreted Protein (817)
- ES Cell Differentiation/IPS (607)
- Stem cell - Pluripotency (373)
- Protease (329)
- GPCR (278)
- Adult stem cells (133)
- Phosphatase (114)
- Embryonic stem cells (98)
- Cancer stem cells (93)
- Stem cell relevant signaling - JAK/STAT signaling pathway (93)
- Nuclear Hormone Receptor (75)
- Induced pluripotent stem cells (57)
- Ion Channels: Other (55)
- P450 (55)
- Stem cell relevant signaling - DSL/Notch pathway (50)
- Ion Channels: Potassium (43)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (35)
- Ion Channels: Glutamate Receptors (30)
- Ion Channels: Transient receptor potential (27)
- Stem cell relevant signaling - Wnt Signaling pathway (25)
- Ion Channels: Cys-loop Receptors (16)
- Ion Channels: Sodium (14)
- Ion Channels: Cyclic nucleotide gated (7)
- Ion Channels: Calcium (5)
- Ion Channels: ATP Receptors (1)
Pathways
- Pathways in cancer (854)
- Metabolic pathways (595)
- MAPK signaling pathway (591)
- Focal adhesion (478)
- Neurotrophin signaling pathway (390)
- Regulation of actin cytoskeleton (375)
- Prostate cancer (372)
- Chemokine signaling pathway (349)
- ErbB signaling pathway (343)
- Chronic myeloid leukemia (310)
- Cytokine-cytokine receptor interaction (308)
- Insulin signaling pathway (305)
- Colorectal cancer (294)
- Pancreatic cancer (287)
- T cell receptor signaling pathway (276)
- Cell cycle (275)
- Neuroactive ligand-receptor interaction (269)
- Apoptosis (254)
- Small cell lung cancer (251)
- Endocytosis (248)
- Toll-like receptor signaling pathway (245)
- Alzheimer's disease (243)
- Melanoma (243)
- Glioma (240)
- Acute myeloid leukemia (239)
- Wnt signaling pathway (237)
- Calcium signaling pathway (236)
- Leukocyte transendothelial migration (233)
- GnRH signaling pathway (226)
- Jak-STAT signaling pathway (225)
- Fc gamma R-mediated phagocytosis (223)
- B cell receptor signaling pathway (221)
- Progesterone-mediated oocyte maturation (218)
- Non-small cell lung cancer (209)
- Natural killer cell mediated cytotoxicity (208)
- Axon guidance (206)
- Adipocytokine signaling pathway (204)
- Endometrial cancer (203)
- Adherens junction (202)
- Epithelial cell signaling in Helicobacter pylori infection (200)
- Huntington's disease (197)
- VEGF signaling pathway (195)
- Oocyte meiosis (192)
- Fc epsilon RI signaling pathway (189)
- Renal cell carcinoma (189)
- Tight junction (179)
- p53 signaling pathway (179)
- Bladder cancer (173)
- Melanogenesis (173)
- Gap junction (162)
- Vascular smooth muscle contraction (160)
- Amyotrophic lateral sclerosis (ALS) (151)
- NOD-like receptor signaling pathway (147)
- Long-term potentiation (146)
- mTOR signaling pathway (144)
- RIG-I-like receptor signaling pathway (134)
- Ubiquitin mediated proteolysis (129)
- Cell adhesion molecules (CAMs) (125)
- TGF-beta signaling pathway (124)
- Long-term depression (119)
- Pathogenic Escherichia coli infection (119)
- Olfactory transduction (117)
- Parkinson's disease (116)
- Type II diabetes mellitus (113)
- Hematopoietic cell lineage (104)
- ECM-receptor interaction (94)
- Dilated cardiomyopathy (88)
- Cytosolic DNA-sensing pathway (87)
- Hypertrophic cardiomyopathy (HCM) (87)
- Thyroid cancer (85)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (82)
- Basal cell carcinoma (79)
- Viral myocarditis (78)
- Complement and coagulation cascades (74)
- PPAR signaling pathway (74)
- Purine metabolism (74)
- Dorso-ventral axis formation (65)
- Prion diseases (65)
- Glycolysis / Gluconeogenesis (64)
- Systemic lupus erythematosus (64)
- Phosphatidylinositol signaling system (62)
- Oxidative phosphorylation (61)
- Vibrio cholerae infection (56)
- Notch signaling pathway (55)
- Lysosome (54)
- Antigen processing and presentation (51)
- Arginine and proline metabolism (50)
- Hedgehog signaling pathway (50)
- ABC transporters (47)
- Drug metabolism - cytochrome P450 (47)
- Metabolism of xenobiotics by cytochrome P450 (47)
- Cardiac muscle contraction (44)
- Primary immunodeficiency (44)
- Glycerolipid metabolism (40)
- Ribosome (39)
- Spliceosome (39)
- Pyrimidine metabolism (38)
- Arachidonic acid metabolism (37)
- Homologous recombination (37)
- Inositol phosphate metabolism (35)
- Nucleotide excision repair (35)
- Tyrosine metabolism (35)
- Pyruvate metabolism (34)
- Retinol metabolism (34)
- Type I diabetes mellitus (34)
- Fructose and mannose metabolism (32)
- Taste transduction (32)
- Alanine (31)
- Base excision repair (31)
- Tryptophan metabolism (31)
- Valine (31)
- aspartate and glutamate metabolism (31)
- DNA replication (30)
- Fatty acid metabolism (30)
- leucine and isoleucine degradation (29)
- Butanoate metabolism (26)
- Mismatch repair (26)
- Regulation of autophagy (26)
- Renin-angiotensin system (26)
- SNARE interactions in vesicular transport (26)
- Glutathione metabolism (24)
- Glycerophospholipid metabolism (24)
- Pentose phosphate pathway (24)
- Proteasome (24)
- Starch and sucrose metabolism (24)
- Androgen and estrogen metabolism (23)
- Cysteine and methionine metabolism (23)
- Graft-versus-host disease (23)
- Histidine metabolism (23)
- Nitrogen metabolism (23)
- Autoimmune thyroid disease (21)
- Citrate cycle (TCA cycle) (21)
- Galactose metabolism (20)
- RNA degradation (20)
- Allograft rejection (19)
- Amino sugar and nucleotide sugar metabolism (19)
- Basal transcription factors (19)
- Lysine degradation (19)
- Drug metabolism - other enzymes (18)
- Maturity onset diabetes of the young (18)
- Non-homologous end-joining (18)
- Biosynthesis of unsaturated fatty acids (17)
- Primary bile acid biosynthesis (17)
- Propanoate metabolism (17)
- Linoleic acid metabolism (16)
- beta-Alanine metabolism (16)
- Ether lipid metabolism (15)
- Sphingolipid metabolism (15)
- N-Glycan biosynthesis (14)
- Porphyrin and chlorophyll metabolism (14)
- C21-Steroid hormone metabolism (13)
- Glycine (13)
- Phenylalanine metabolism (13)
- serine and threonine metabolism (13)
- Asthma (12)
- Limonene and pinene degradation (12)
- Ascorbate and aldarate metabolism (11)
- Folate biosynthesis (11)
- Nicotinate and nicotinamide metabolism (11)
- Taurine and hypotaurine metabolism (11)
- Aminoacyl-tRNA biosynthesis (10)
- Pentose and glucuronate interconversions (10)
- Riboflavin metabolism (10)
- alpha-Linolenic acid metabolism (9)
- Selenoamino acid metabolism (8)
- Terpenoid backbone biosynthesis (8)
- Caffeine metabolism (6)
- Chondroitin sulfate biosynthesis (6)
- Fatty acid biosynthesis (6)
- Glycosaminoglycan degradation (6)
- Glyoxylate and dicarboxylate metabolism (6)
- Other glycan degradation (6)
- RNA polymerase (6)
- Steroid biosynthesis (6)
- Heparan sulfate biosynthesis (5)
- One carbon pool by folate (5)
- Pantothenate and CoA biosynthesis (5)
- Glycosphingolipid biosynthesis - ganglio series (4)
- Lysine biosynthesis (4)
- Phenylalanine (4)
- leucine and isoleucine biosynthesis (4)
- tyrosine and tryptophan biosynthesis (4)
- Circadian rhythm - mammal (3)
- Cyanoamino acid metabolism (3)
- Fatty acid elongation in mitochondria (3)
- Glycosphingolipid biosynthesis - lacto and neolacto series (3)
- Keratan sulfate biosynthesis (3)
- Methane metabolism (3)
- Sulfur metabolism (3)
- Synthesis and degradation of ketone bodies (3)
- Vitamin B6 metabolism (3)
- D-Glutamine and D-glutamate metabolism (2)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (2)
- O-Glycan biosynthesis (2)
- Protein export (2)
- Ubiquinone and other terpenoid-quinone biosynthesis (2)
- Glycosphingolipid biosynthesis - globo series (1)
- O-Mannosyl glycan biosynthesis (1)
- Thiamine metabolism (1)