Germany
Japan
United Kingdom
China
Rabbit anti-AHCY Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human AHCY |
Antibodies
View as table Download
Rabbit Polyclonal Anti-PAPSS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PAPSS2 antibody: synthetic peptide directed towards the C terminal of human PAPSS2. Synthetic peptide located within the following region: PARHNEFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTDYYRSLEKN |
Rabbit Polyclonal Anti-MAT1A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAT1A antibody: synthetic peptide directed towards the N terminal of human MAT1A. Synthetic peptide located within the following region: TSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVCKTGMVLLCGE |
Rabbit Polyclonal antibody to WBSCR22 (Williams Beuren syndrome chromosome region 22)
| Applications | IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 263 of WBSCR22 (Uniprot ID#O43709) |
Rabbit Polyclonal Anti-MAT1A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAT1A antibody: synthetic peptide directed towards the C terminal of human MAT1A. Synthetic peptide located within the following region: VAKSLVKAGLCRRVLVQVSYAIGVAEPLSISIFTYGTSQKTERELLDVVH |
Rabbit Polyclonal Anti-LCMT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LCMT2 antibody: synthetic peptide directed towards the C terminal of human LCMT2. Synthetic peptide located within the following region: PVLSDWHFLHVGTMAWVRIPVEGEVPEARHSHSACTWQGGALIAGGLGAS |
Rabbit Polyclonal Anti-METTL2B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-METTL2B antibody: synthetic peptide directed towards the N terminal of human METTL2B. Synthetic peptide located within the following region: AGSYPEGAPAILADKRQQFGSRFLSDPARVFHHNAWDNVEWSEEQAAAAE |
Rabbit Polyclonal Anti-METTL2B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-METTL2B antibody: synthetic peptide directed towards the N terminal of human METTL2B. Synthetic peptide located within the following region: INAHKYWNDFYKIHENGFFKDRHWLFTEFPELAPSQNQNHLKDWFLENKS |
Rabbit Polyclonal Anti-AHCYL2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-AHCYL2 Antibody is: synthetic peptide directed towards the N-terminal region of Human AHCYL2. Synthetic peptide located within the following region: TDSYSSAASYTDSSDDETSPRDKQQKNSKGSSDFCVKNIKQAEFGRREIE |
Rabbit Polyclonal Anti-AHCY Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AHCY antibody: synthetic peptide directed towards the N terminal of human AHCY. |
Rabbit polyclonal Anti-METTL6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-METTL6 antibody: synthetic peptide directed towards the N terminal of human METTL6. Synthetic peptide located within the following region: QKLEQEAQKNWDLFYKRNSTNFFKDRHWTTREFEELRSCREFEDQKLTML |
Rabbit Polyclonal Anti-MARS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MARS antibody: synthetic peptide directed towards the middle region of human MARS. Synthetic peptide located within the following region: GHQIGTVSPLFQKLENDQIESLRQRFGGGQAKTSPKPAVVETVTTAKPQQ |
Rabbit Polyclonal Anti-WDHD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WDHD1 antibody: synthetic peptide directed towards the middle region of human WDHD1. Synthetic peptide located within the following region: KQILHGDPLPLTRKSYLAWIGFSAEGTPCYVDSEGIVRMLNRGLGNTWTP |
Rabbit Polyclonal Anti-AHCYL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-AHCYL1 Antibody: synthetic peptide directed towards the N terminal of human AHCYL1. Synthetic peptide located within the following region: TDSYSSAASYTDSSDDEVSPREKQQTNSKGSSNFCVKNIKQAEFGRREIE |
Rabbit Polyclonal Anti-AHCYL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-AHCYL1 Antibody: synthetic peptide directed towards the N terminal of human AHCYL1. Synthetic peptide located within the following region: MSMPDAMPLPGVGEELKQAKEIEDAEKYSFMATVTKAPKKQIQFADDMQE |
Anti-MAT1A Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 16-394 amino acids of human methionine adenosyltransferase I, alpha |
Anti-MAT1A Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 16-394 amino acids of human methionine adenosyltransferase I, alpha |
Anti-WBSCR22 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 263-281 amino acids of human Williams Beuren syndrome chromosome region 22 |
Rabbit Polyclonal Anti-PAPSS1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PAPSS1 |
Active filters
Category
- Antibodies
Antibody Hosts
- Rabbit
Isotypes
- IgG
Conjugates
- Unconjugated
Families
- Druggable Genome
Pathways
- Selenoamino acid metabolism