Antibodies

View as table Download

Rabbit anti-EZH2 Polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human EZH2

Rabbit Polyclonal EzH2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-EzH2 antibody: the N-terminus (aa1-343) of the mouse EZH2 protein (Enhancer of zeste homolog 2).

Rabbit Polyclonal Anti-EZH2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-EZH2 Antibody: A synthesized peptide derived from human EZH2

Rabbit Polyclonal EZH2 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen EZH2 antibody was raised against a 17 amino acid synthetic peptide near the amino terminus of human EZH2.

Rabbit Polyclonal KMT6/EZH2 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

Rabbit Polyclonal Anti-EZH2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EZH2 antibody: synthetic peptide directed towards the N terminal of human EZH2. Synthetic peptide located within the following region: KGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQE

Rabbit polyclonal anti-EZH2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide mapping to the N-terminus of rat Ezh2

Rabbit Polyclonal Anti-EZH2 Antibody

Applications ELISA, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human EZH2