Rabbit Polyclonal Anti-ACO1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACO1 antibody: synthetic peptide directed towards the N terminal of human ACO1. Synthetic peptide located within the following region: MSNPFAHLAEPLDPVQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNC |
Rabbit Polyclonal antibody to MDH2 (malate dehydrogenase 2, NAD (mitochondrial))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 40 and 319 of MDH2 (Uniprot ID#P40926) |
Rabbit Polyclonal antibody to Citrate synthetase (citrate synthase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 110 and 412 of Citrate synthetase (Uniprot ID#O75390) |
Rabbit Polyclonal Anti-GRHPR Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GRHPR antibody: synthetic peptide directed towards the N terminal of human GRHPR. Synthetic peptide located within the following region: EPIPAKELERGVAGAHGLLCLLSDHVDKRILDAAGANLKVISTMSVGIDH |
Rabbit Polyclonal Anti-MDH2 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MDH2 antibody: synthetic peptide directed towards the C terminal of human MDH2. Synthetic peptide located within the following region: TYFSTPLLLGKKGIEKNLGIGKVSSFEEKMISDAIPELKASIKKGEDFVK |
MDH1 rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Immunogen | Malic dehydrogenase is isolated and purified from Human erythrocytes. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
MDH1 rabbit polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Malic dehydrogenase is isolated and purified from Human erythrocytes. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
MDH1 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Immunogen | Malic dehydrogenase is isolated and purified from Human erythrocytes. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
MDH1 rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Immunogen | Malic dehydrogenase is isolated and purified from Human placenta. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
MDH1 rabbit polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Malic dehydrogenase is isolated and purified from Human placenta. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
MDH1 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Immunogen | Malic dehydrogenase is isolated and purified from Human placenta. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit Polyclonal Anti-HAO2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HAO2 antibody: synthetic peptide directed towards the N terminal of human HAO2. Synthetic peptide located within the following region: DDNIAAFKRIRLRPRYLRDVSEVDTRTTIQGEEISAPICIAPTGFHCLVW |
Rabbit Polyclonal Antibody against ACO2 (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ACO2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 294-325 amino acids from the Central region of human ACO2. |
Rabbit Polyclonal Anti-HAO1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HAO1 antibody: synthetic peptide directed towards the C terminal of human HAO1. Synthetic peptide located within the following region: GLNGILVSNHGARQLDGVPATIDVLPEIVEAVEGKVEVFLDGGVRKGTDV |
Rabbit Polyclonal Anti-MDH1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MDH1 antibody: synthetic peptide directed towards the middle region of human MDH1. Synthetic peptide located within the following region: NFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKV |
Rabbit polyclonal MTHFD2 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This MTHFD2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 271-299 amino acids from the C-terminal region of human MTHFD2. |
Rabbit Polyclonal Anti-MTHFD1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MTHFD1 antibody: synthetic peptide directed towards the N terminal of human MTHFD1. Synthetic peptide located within the following region: RTTTESEVMKYITSLNEDSTVHGFLVQLPLDSENSINTEEVINAIAPEKD |
Aconitase 1 (ACO1) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Aconitase 1 (ACO1) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
Rabbit polyclonal IREB1 / ACO1 (Ser711) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IREB1 around the phosphorylation site of serine 711 (Y-G-SP-R-R). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-MTHFD1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MTHFD1 antibody: synthetic peptide directed towards the middle region of human MTHFD1. Synthetic peptide located within the following region: CMAKTHLSLSHNPEQKGVPTGFILPIRDIRASVGAGFLYPLVGTMSTMPG |
Rabbit Polyclonal Anti-MTHFD2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MTHFD2 antibody: synthetic peptide directed towards the N terminal of human MTHFD2. Synthetic peptide located within the following region: EAVVISGRKLAQQIKQEVRQEVEEWVASGNKRPHLSVILVGENPASHSYV |
Rabbit Polyclonal Anti-PGP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PGP antibody is: synthetic peptide directed towards the C-terminal region of PGP. Synthetic peptide located within the following region: TDILLGATCGLKTILTLTGVSTLGDVKNNQESDCVSKKKMVPDFYVDSIA |
MDH1 (C-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human MDH1 |
MDH2 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human MDH2 |
HAO1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human HAO1 |
Rabbit Polyclonal Anti-MTHFD2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MTHFD2 antibody: synthetic peptide directed towards the N terminal of human MTHFD2. Synthetic peptide located within the following region: LPLPEHIDERRICNAVSPDKDVDGFHVINVGRMCLDQYSMLPATPWGVWE |
Rabbit Polyclonal Anti-MTHFD2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MTHFD2 antibody: synthetic peptide directed towards the middle region of human MTHFD2. Synthetic peptide located within the following region: VWEIIKRTGIPTLGKNVVVAGRSKNVGMPIAMLLHTDGAHERPGGDATVT |
Rabbit Polyclonal Anti-MTHFD2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MTHFD2 antibody: synthetic peptide directed towards the N terminal of human MTHFD2. Synthetic peptide located within the following region: VILVGENPASHSYVLNKTRAAAVVGINSETIMKPASISEEELLNLINKLN |
Rabbit Polyclonal Anti-GLYCTK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GLYCTK antibody: synthetic peptide directed towards the N terminal of human GLYCTK. Synthetic peptide located within the following region: IQQLAEGLTADDLLLVLISGGGSALLPAPIPPVTLEEKQTLTRLLAARGA |
Rabbit Polyclonal Anti-GLYCTK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GLYCTK antibody: synthetic peptide directed towards the middle region of human GLYCTK. Synthetic peptide located within the following region: KPHSRVQVFEGAEDNLPDRDALRAALAIQQLAEGLTADDLLLVLISGGGS |
Anti-ACO1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 132-146 amino acids of human aconitase 1, soluble |
Anti-ACO1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 132-146 amino acids of human aconitase 1, soluble |
Rabbit Polyclonal Anti-MDH1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MDH1 |
HYI Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
HYI Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
