Enkephalin (PENK) rabbit polyclonal antibody
Applications | IHC |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Enkephalin (PENK) rabbit polyclonal antibody
Applications | IHC |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Enkephalin (PENK) rabbit polyclonal antibody
Applications | IF, IHC |
Reactivities | Birds, Mammalian |
Conjugation | Unconjugated |
Immunogen | Synthetic methionine enkephalin coupled to bovine thyroglobulin (BTg) with glutaraldehyde. |
Rabbit Polyclonal Anti-PENK Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PENK antibody: synthetic peptide directed towards the middle region of human PENK. Synthetic peptide located within the following region: DAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRG |
Rabbit polyclonal anti Met-Enkephalin; neat antiserum
Applications | ELISA |
Reactivities | Human, Mammalian |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide H-Try-Gly-Gly-Phe-Met-OH coupled to carrier protein. |
Enkephalin (PENK) rabbit polyclonal antibody
Applications | IF, IHC |
Reactivities | Mammalian |
Conjugation | Unconjugated |
Immunogen | Synthetic leucine enkephalin coupled to keyhole limpet hemocyanin (KLH) to bovine thyroglobulin and BSA with glutaraldehyde. |
Rabbit polyclonal anti BAM-12P; purified rabbit IgG
Applications | ELISA |
Reactivities | Human, Mammalian |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide H-Try-Gly-Gly-Phe-Met-Arg-Arg-Val-Gly-Arg-Pro-Glu- NH2 coupled to a carrier protein. |
Rabbit polyclonal anti BAM-22P; neat antiserum
Applications | ELISA |
Reactivities | Human, Mammalian |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide H-Tyr-Gly-Gly-Phe-Met-Arg-Arg-Val-Gly-Arg-Pro-Glu- Trp-Trp-Met-Asp-Tyr-Gln-Lys-Arg-Tyr-Gly-NH2 coupled to a carrier protein. |
Rabbit polyclonal anti BAM-22P; purified rabbit IgG
Applications | ELISA |
Reactivities | Human, Mammalian |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide H-Tyr-Gly-Gly-Phe-Met-Arg-Arg-Val-Gly-Arg-Pro-Glu- Trp-Trp-Met-Asp-Tyr-Gln-Lys-Arg-Tyr-Gly-NH2 coupled to a carrier protein. |
Rabbit polyclonal anti BAM-12P; neat antiserum
Applications | ELISA |
Reactivities | Human, Mammalian |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide H-Try-Gly-Gly-Phe-Met-Arg-Arg-Val-Gly-Arg-Pro-Glu- NH2 coupled to carrier protein. |
Rabbit polyclonal anti Leu-Enkephalin; diluted antiserum
Applications | ELISA |
Reactivities | Human, Mammalian |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide H-Tyr-Gly-Gly-Phe-Leu-NH2 coupled to carrier protein. |
Rabbit polyclonal anti Leu-Enkephalin; purified rabbit IgG
Applications | ELISA |
Reactivities | Human, Mammalian |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide H-Tyr-Gly-Gly-Phe-Leu-NH2 coupled to a carrier protein. |
Rabbit polyclonal anti Leu-Enkephalin; neat antiserum
Applications | ELISA |
Reactivities | Human, Mammalian |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide H-Tyr-Gly-Gly-Phe-Leu-NH2 coupled to carrier protein. |
Rabbit polyclonal anti Met-Enkephalin; diluted antiserum
Applications | ELISA |
Reactivities | Human, Mammalian |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide H-Try-Gly-Gly-Phe-Met-OH coupled to carrier protein. |
Rabbit polyclonal anti Met-Enkephalin-Arg-Gly-Leu; neat antiserum
Applications | ELISA |
Reactivities | Human, Mammalian |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide H-Tyr-Gly-Gly-Phe-Met-Arg-Gly-Leu-NH2 coupled to carrier protein. |
Rabbit polyclonal anti Met-Enkephalin-Arg-Gly-Leu; purified rabbit IgG
Applications | ELISA |
Reactivities | Human, Mammalian |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide H-Tyr-Gly-Gly-Phe-Met-Arg-Gly-Leu-NH2 coupled to a carrier protein. |
Rabbit polyclonal anti Met-Enkephalin; purified rabbit IgG
Applications | ELISA |
Reactivities | Human, Mammalian |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide H-Try-Gly-Gly-Phe-Met-OH coupled to a carrier protein. |
Rabbit polyclonal anti Met-Enkephalin-Arg-Phe; neat antiserum
Applications | ELISA |
Reactivities | Human, Mammalian |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide H-Tyr-Gly-Gly-Phe-Met-Arg-Phe-NH2 coupled to carrier protein. |
Rabbit polyclonal anti Met-Enkephalin-Arg-Phe; purified rabbit IgG
Applications | ELISA |
Reactivities | Human, Mammalian |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide H-Tyr-Gly-Gly-Phe-Met-Arg-Phe-NH2 coupled to a carrier protein. |
Rabbit polyclonal anti Peptide F (bo); purified rabbit IgG
Applications | ELISA |
Reactivities | Bovine |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide H-Tyr-Gly-Gly-Phe-Met-Lys-Lys-Met-Asp-Glu-Leu-Tyr- Pro-Leu-Glu-Val-Glu-Glu-Glu-Ala-Asn-Gly-Gly-Glu-Val-Leu-Gly-Lys-Arg- Tyr-Gly-Gly-Phe-Met-OH coupled to a carrier protein. |
Rabbit polyclonal anti Peptide F (bo); neat antiserum
Applications | ELISA |
Reactivities | Bovine |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide H-Tyr-Gly-Gly-Phe-Met-Lys-Lys-Met-Asp-Glu-Leu-Tyr- Pro-Leu-Glu-Val-Glu-Glu-Glu-Ala-Asn-Gly-Gly-Glu-Val-Leu-Gly-Lys-Arg- Tyr-Gly-Gly-Phe-Met-OH coupled to carrier protein. |
PENK Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 25-267 of human PENK (NP_001129162.1). |
Modifications | Unmodified |